DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and Irx3

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001240751.1 Gene:Irx3 / 16373 MGIID:1197522 Length:522 Species:Mus musculus


Alignment Length:237 Identity:54/237 - (22%)
Similarity:85/237 - (35%) Gaps:92/237 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 PDVRPPSSSLSYGGAMNDDARSPGAGSTPGPLSQQPPALDTSDPDGKFLSSLNPSELTYDGRWCR 304
            |..||.::....||:.......||||:                           |||...|    
Mouse    16 PPERPGAAGGGGGGSSAGGRSGPGAGA---------------------------SELAASG---- 49

  Fly   305 REWSSPADARNADASRRLYSSVFLGSPDNFGTSASGDASNASIGSGE--------------GTGE 355
                         :...:.|||: |:|    .:|:..|:.|:.|.|.              |...
Mouse    50 -------------SLSNVLSSVY-GAP----YAAAAAAAAAAQGYGAFLPYATELPIFPQLGAQY 96

  Fly   356 EDDDASGKKNQKKRGIFP------------------------KVATNILRAWLFQHLTHPYPSED 396
            |..|:.|.::......||                        :.:|:.|:|||.:|..:|||::.
Mouse    97 ELKDSPGVQHPATAAAFPHPHPAFYPYGQYQFGDPSRPKNATRESTSTLKAWLNEHRKNPYPTKG 161

  Fly   397 QKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYTP 438
            :|..||..|.:|:.||:.||.|||||     :.:.|:..:.|
Mouse   162 EKIMLAIITKMTLTQVSTWFANARRR-----LKKENKMTWAP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 18/38 (47%)
Irx3NP_001240751.1 Homeobox_KN 148..187 CDD:283551 18/38 (47%)
IRO 345..362 CDD:214716
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.