Sequence 1: | NP_476576.1 | Gene: | hth / 41273 | FlyBaseID: | FBgn0001235 | Length: | 487 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034703.2 | Gene: | Irx1 / 16371 | MGIID: | 1197515 | Length: | 480 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 50/196 - (25%) |
---|---|---|---|
Similarity: | 79/196 - (40%) | Gaps: | 55/196 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 259 ARSPGA--GSTPGPLSQQPPALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPADARNADASRR 321
Fly 322 LYSSV--FLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASG---------------------- 362
Fly 363 -----KKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 422
Fly 423 I 423 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hth | NP_476576.1 | Meis_PKNOX_N | 127..211 | CDD:406806 | |
Homeobox_KN | 383..422 | CDD:399131 | 18/38 (47%) | ||
Irx1 | NP_034703.2 | Homeobox_KN | 145..184 | CDD:283551 | 18/38 (47%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 190..285 | ||||
SDA1 | <194..>252 | CDD:283052 | |||
IRO | 309..326 | CDD:214716 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 318..354 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 401..480 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0773 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |