DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and irx7

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_571956.1 Gene:irx7 / 140746 ZFINID:ZDB-GENE-020103-1 Length:314 Species:Danio rerio


Alignment Length:193 Identity:47/193 - (24%)
Similarity:77/193 - (39%) Gaps:46/193 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 PSSSLSYGG-AMNDDARSPGA----GSTPGPLSQQPPAL---------DTSDPDGKFLSSLNPSE 295
            |:||..:.. .|:.:...|..    |..|| :.|.||.|         .:..|...|:...:|..
Zfish     2 PASSTGFANFFMDRNINMPAGYQLLGCPPG-MQQPPPHLVGMAGMPLPFSGIPGYSFIPYPHPGH 65

  Fly   296 LTYDGRWCRREWSSPADARNADASRRLYSSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDA 360
            :.:.......:.:||            |....||....:.|......:              ||.
Zfish    66 MAHISNSYDLKAASP------------YHQALLGRGGPYYTPYRPIPA--------------DDP 104

  Fly   361 SGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRI 423
            |     :...:..:.:|:.|:|||.:||.:|||::.:|..||..|.:::.||:.||.|||||:
Zfish   105 S-----RVTKVATRESTSALKAWLSEHLKNPYPTKGEKIMLAIVTKMSLTQVSTWFANARRRL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 18/38 (47%)
irx7NP_571956.1 Homeobox_KN 122..161 CDD:283551 18/38 (47%)
IRO 255..269 CDD:214716
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.