DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and LOC1279407

DIOPT Version :10

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_319123.5 Gene:LOC1279407 / 1279407 VectorBaseID:AGAMI1_004277 Length:497 Species:Anopheles gambiae


Alignment Length:62 Identity:23/62 - (37%)
Similarity:38/62 - (61%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 GKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRI 423
            |..::..:.:|......:|:.||.:...:|||:.::||.||.:||||..|:.|||.|.||::
Mosquito    21 GDSHRPVKRLFTPEIKRMLKDWLVRRRENPYPNREEKKLLAVETGLTYTQICNWFANWRRKL 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:465140
Homeobox_KN 384..422 CDD:428673 18/37 (49%)
LOC1279407XP_319123.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.