DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and LOC1270088

DIOPT Version :10

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_061498467.1 Gene:LOC1270088 / 1270088 VectorBaseID:AGAMI1_009170 Length:503 Species:Anopheles gambiae


Alignment Length:145 Identity:48/145 - (33%)
Similarity:68/145 - (46%) Gaps:34/145 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 SSPADARNADASRRLYSSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIF 372
            ||..|...:|....|                 ||.:..|...|..|....:.:|   ::|:||..
Mosquito    60 SSADDTEGSDQEHTL-----------------GDITYKSEADGNDTMNSSNQSS---SRKRRGNL 104

  Fly   373 PKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYT 437
            ||.:..||:.||::|..:.||::.:|..|:|:..||:|||.||||||||||:..||.:.      
Mosquito   105 PKQSVKILKRWLYEHRFNAYPTDAEKLTLSQEANLTVLQVCNWFINARRRILPEMIRRD------ 163

  Fly   438 PHPGPSGYGHDAMGY 452
                    |||.|.|
Mosquito   164 --------GHDPMHY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:465140
Homeobox_KN 384..422 CDD:428673 19/37 (51%)
LOC1270088XP_061498467.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.