DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and LOC1269377

DIOPT Version :10

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_061504336.1 Gene:LOC1269377 / 1269377 VectorBaseID:AGAMI1_010406 Length:150 Species:Anopheles gambiae


Alignment Length:148 Identity:133/148 - (89%)
Similarity:133/148 - (89%) Gaps:2/148 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 GDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQD 404
            |||||.||||||||||||||.||||||||||||||||||||||||||||||||||||||||||||
Mosquito     5 GDASNTSIGSGEGTGEEDDDTSGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQD 69

  Fly   405 TGLTILQVNNWFINARRRIVQPMIDQSNRAVYTPHPGPSGYGHDAMGYMMDSQAHMMHRPPGDPG 469
            ||||||||||||||||||||||||||||||||| |||||....|||.||||.||.||||.||||.
Mosquito    70 TGLTILQVNNWFINARRRIVQPMIDQSNRAVYT-HPGPSAGYPDAMSYMMDGQAQMMHRAPGDPA 133

  Fly   470 FHQGYPHYPPAEYYGQHL 487
            ||||| ||||||||..||
Mosquito   134 FHQGY-HYPPAEYYPHHL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:465140
Homeobox_KN 384..422 CDD:428673 37/37 (100%)
LOC1269377XP_061504336.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.