Sequence 1: | NP_476576.1 | Gene: | hth / 41273 | FlyBaseID: | FBgn0001235 | Length: | 487 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571898.1 | Gene: | irx1b / 114430 | ZFINID: | ZDB-GENE-010716-1 | Length: | 445 | Species: | Danio rerio |
Alignment Length: | 245 | Identity: | 60/245 - (24%) |
---|---|---|---|
Similarity: | 92/245 - (37%) | Gaps: | 66/245 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 249 LSYGGAMNDDARSPGAGSTPG--PLSQQPPALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPA 311
Fly 312 DARNADASRRLYSSVFLGS----PDNFGTSASGDASNASIG-SGEGTGEEDDDASGKKNQKKRGI 371
Fly 372 FPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRI------------- 423
Fly 424 ----------------------------------VQPMIDQSNRAVYTPH 439 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hth | NP_476576.1 | Meis_PKNOX_N | 127..211 | CDD:406806 | |
Homeobox_KN | 383..422 | CDD:399131 | 18/38 (47%) | ||
irx1b | NP_571898.1 | COG5576 | <114..206 | CDD:227863 | 26/98 (27%) |
Homeobox_KN | 135..174 | CDD:283551 | 18/38 (47%) | ||
IRO | 287..304 | CDD:214716 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0773 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |