DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and tgif2

DIOPT Version :10

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_005168761.1 Gene:tgif2 / 100535338 ZFINID:ZDB-GENE-131029-1 Length:377 Species:Danio rerio


Alignment Length:158 Identity:43/158 - (27%)
Similarity:69/158 - (43%) Gaps:47/158 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 EWSSPADARNADASRRLYSSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRG 370
            |:|:.:|:...:.|.        |.|.|..||.....|:|                   .:::||
Zfish    17 EFSAMSDSDPCEDSD--------GFPLNLSTSGRRSGSSA-------------------KRRRRG 54

  Fly   371 IFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR-- 433
            ..||.:..:||.||::|..:.||||.:|..|:..|.|::.|:.|||||||||::..::.:..:  
Zfish    55 NLPKESVQVLRDWLYEHRFNAYPSEQEKLSLSGQTHLSVSQICNWFINARRRLLPDLLRKDGKDP 119

  Fly   434 ------------------AVYTPHPGPS 443
                              ..:||.|.||
Zfish   120 TQFTMSRRTSKPDRSASPECHTPLPRPS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:465140
Homeobox_KN 384..422 CDD:428673 18/37 (49%)
tgif2XP_005168761.1 Homeobox_KN 68..103 CDD:428673 15/34 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.