DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and pbx3

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_031747329.1 Gene:pbx3 / 100495648 XenbaseID:XB-GENE-479458 Length:434 Species:Xenopus tropicalis


Alignment Length:394 Identity:83/394 - (21%)
Similarity:131/394 - (33%) Gaps:150/394 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 PREPGVQGGDVCSSESFNEDIAMFSKQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHEL 184
            |...|..|||   .:...:||.....||.:     ..|..:|.  .||            |.|.|
 Frog    28 PPPHGHDGGD---GDGRKQDIGDILHQIMT-----ITDQSLDE--AQA------------KKHAL 70

  Fly   185 CDNFCHRY------ISC-LKGKMPIDLVIDERDTTKPPELGSANGEGRSNADSTSHTDGASTPDV 242
               .|||.      :.| :|.|..:.:...:.:....|:|        ...|:....:|.|.|:.
 Frog    71 ---NCHRMKPALFSVLCEIKEKTGLSIRGAQEEDPPDPQL--------MRLDNMLLAEGVSGPEK 124

  Fly   243 RPPSSSLSYGGAMNDDARSPGAGSTPGPLSQQPPALDTSDPDGKF--LSSLNPSELTYDGRWCR- 304
            ...|::.:...|      :.|.||:..       :::.||...|.  :..:..:||....:.|. 
 Frog   125 GGGSAAAAAAAA------ASGGGSSDN-------SIEHSDYRAKLSQIRQIYHTELEKYEQACNE 176

  Fly   305 ---------REWS-----SPAD-ARNADASRRLYSSV------------------FLGSPDNFGT 336
                     ||.|     ||.: .|......|.:||:                  ||        
 Frog   177 FTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFL-------- 233

  Fly   337 SASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQL 401
                                  ||     ::||..|.|.||.||..:.:.||::|||||:.|::|
 Frog   234 ----------------------DA-----RRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEEL 271

  Fly   402 AQDTGLTILQVNNWF--------------------------INARRRIVQPMIDQSNRAVYTPHP 440
            |:...:|:.||:|||                          :||...:...:.:....:..||:.
 Frog   272 AKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVNAAHAVAAAVQNNQTSSPTTPNS 336

  Fly   441 GPSG 444
            |.||
 Frog   337 GSSG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806 20/90 (22%)
Homeobox_KN 383..422 CDD:399131 18/64 (28%)
pbx3XP_031747329.1 PBC 42..234 CDD:397732 45/264 (17%)
homeodomain 236..296 CDD:238039 24/59 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.