DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and Tgif2lx2

DIOPT Version :10

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001136222.1 Gene:Tgif2lx2 / 100039551 MGIID:3800824 Length:231 Species:Mus musculus


Alignment Length:121 Identity:35/121 - (28%)
Similarity:56/121 - (46%) Gaps:28/121 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 EGTGEEDDD------ASGKKNQK------------KRG-IFPKVATNILRAWLFQHLTHPYPSED 396
            ||:.||..|      :.|.:.::            .|| :.|..:..|||.||.:|..:.||:..
Mouse     5 EGSPEETQDFMKYYSSFGIRLERTCKMKFHDSRELPRGNMLPLKSVKILRDWLCEHQFNAYPTVA 69

  Fly   397 QKKQLAQDTGLTILQVNNWFINARRRI-----VQPMI----DQSNRAVYTPHPGPS 443
            .|:.|:::|.|:.|||:|||:|.|:.:     .:|..    .|:..|....|..||
Mouse    70 DKRMLSKNTDLSYLQVSNWFVNIRKHLRWEIRYKPYSLSHEGQAANAAQKQHSNPS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:465140
Homeobox_KN 384..422 CDD:428673 16/37 (43%)
Tgif2lx2NP_001136222.1 Homeobox_KN 59..94 CDD:428673 14/34 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.