DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and irx4

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001263621.1 Gene:irx4 / 100038068 XenbaseID:XB-GENE-480570 Length:496 Species:Xenopus tropicalis


Alignment Length:242 Identity:58/242 - (23%)
Similarity:92/242 - (38%) Gaps:83/242 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 ASTPDVRPPSSSL-----SYGGAMNDDARSPGAGSTPGPLSQQPPALDTSDPDGKFLSSLNPSEL 296
            :|||.....::||     |.|.:::|.|.:..|         |.|....                
 Frog    11 SSTPQFLMTTNSLSTCCESSGRSLSDSAAAASA---------QTPVYCP---------------- 50

  Fly   297 TYDGRWCRREWSSPADAR---NADASRRLYSSVF-----LGSPDNFGTSASGDASNASIGSGEGT 353
            .|:.|..       |.||   |:.|:..:|.|.:     .|:...:|..||...|..:..|.:||
 Frog    51 VYESRLL-------ATARHELNSAAALGVYGSPYTSTQGYGNYVTYGADASAFYSLNAFESKDGT 108

  Fly   354 GEED---------------------------DDASGKKNQKKRGIFPKVATNILRAWLFQHLTHP 391
            |...                           |.::.:||..:.      .|:.|:|||.:|..:|
 Frog   109 GSAHAGIPQTAAYYPYEHTLSQYQYDRYGTMDGSTRRKNATRE------TTSTLKAWLQEHRKNP 167

  Fly   392 YPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYTP 438
            ||::.:|..||..|.:|:.||:.||.|||||     :.:.|:..:.|
 Frog   168 YPTKGEKIMLAIITKMTLTQVSTWFANARRR-----LKKENKMTWPP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 18/38 (47%)
irx4NP_001263621.1 Homeobox_KN 159..198 CDD:368670 18/38 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..236 2/7 (29%)
IRO 356..369 CDD:214716
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.