DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12e1 and CYP724A1

DIOPT Version :9

Sequence 1:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001331288.1 Gene:CYP724A1 / 831291 AraportID:AT5G14400 Length:421 Species:Arabidopsis thaliana


Alignment Length:474 Identity:97/474 - (20%)
Similarity:174/474 - (36%) Gaps:112/474 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QYGSIFRMPSVAGTDLVLTMNPQDYEVIFRNEGQYPYRRSFEVMDYFKRVHRREVFDGYDGLTSG 138
            :||.:|: .::.|...|::.:.:....|.:|||:      ....||.|.:|  ::...|      
plant    31 RYGKVFK-SNICGGKAVVSCDQELNMFILQNEGK------LFTSDYPKAMH--DILGKY------ 80

  Fly   139 NGPAWGKMRTAVNPILLQPRNAKLYMTNLVQVSDEFLERIRIIRDPVTQEMPDDFAVDIRHLVIE 203
                  .:..|...|..:.:|..:...||.:...:||.....:...:.:...:...|:....|..
plant    81 ------SLLLATGEIHRKLKNVIISFINLTKSKPDFLHCAENLSISILKSWKNCREVEFHKEVKI 139

  Fly   204 SICSVALNTHLGLLGEQRNNKDIQKLVLALQDVVELGFQLDIMPAFWKYLPMP-------NFKKL 261
            ...||.:|..|.:..|     |..:|.: |||.      |..|..|.. ||:|       |..|.
plant   140 FTLSVMVNQLLSIKPE-----DPARLYV-LQDF------LSYMKGFIS-LPIPLPGTGYTNAIKA 191

  Fly   262 MRSLDTITDFCYFHIGNALK---RIEEDAKAGTLNEIGLETSLLEKLARFDRQTAVIIAMDLLFA 323
            .:.|..       .:...:|   |.|||.......|..|::.:..:...::.:.:::  :|:|..
plant   192 RKRLSA-------RVMGMIKEREREEEDMNNAIREEDFLDSIISNEDLNYEEKVSIV--LDILLG 247

  Fly   324 GADPTLVTLGGILFSLSKSPDKQARLLEEIRGILPNKDSS--LTIENMRNLPYLRACIKEGIRMY 386
            |.:.:..||..:::.|:|||:...:|.||...|...|...  |..|:.:.:.:.:..|.|.:|. 
plant   248 GFETSATTLSLVVYFLAKSPNLLHKLKEEHAAIRAKKGDGELLNWEDYQKMEFTQCVISEALRC- 311

  Fly   387 PIGPGTLRRMPHDVVLSGYRVVAGTDVGIAANYQMANMEQFVPKVR----EFIPERWLRDESNSH 447
                       ..|:..|::|           :.:.......|.:.    ||.|.||    ::..
plant   312 -----------EYVIPKGWKV-----------FPIFTAVHLDPSLHENPFEFNPMRW----TDKA 350

  Fly   448 LVGETATPFMYLPFGFGPRSCAGKRIVDMMLEIAISRLVRNF--KIGFD-YPIENAFKAQFFVQP 509
            .:.:..|     .||.|.|.|.|..:..:.:...:..||.::  ||..| .||         ..|
plant   351 KMNKKTT-----AFGGGVRVCPGGELGKLQIAFFLHHLVLSYRWKIKSDEMPI---------AHP 401

  Fly   510 NIPFK---------FKFIE 519
            .:.||         .||:|
plant   402 YVEFKRGMLLEIEPTKFLE 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 94/470 (20%)
CYP724A1NP_001331288.1 cytochrome_P450 28..415 CDD:425388 94/467 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.