DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12e1 and CYP712A1

DIOPT Version :9

Sequence 1:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_181754.1 Gene:CYP712A1 / 818826 AraportID:AT2G42250 Length:514 Species:Arabidopsis thaliana


Alignment Length:501 Identity:135/501 - (26%)
Similarity:209/501 - (41%) Gaps:101/501 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AVNLEEAKPYADIPGPSKLQLIRAFLPGGLYKNLPVHEMFLDMNRQYGSIFRMPSVAGTDLVLTM 93
            |..|.::.|  .:|....|.||.        |.|||  .|..:..:||.:..:...|...:|::.
plant    38 ATKLPQSPP--ALPFIGHLHLIG--------KVLPV--SFQSLAHKYGPLMEIRLGASKCVVVSS 90

  Fly    94 NPQDYEVIFRNEGQYPYRRSFEVMDYFKRVHRREVFDGYDGLTSGNGPAWGKMRTAVNPILLQPR 158
            :....|:....|..:..|..|...:|||....|.|...|       |..|..|:           
plant    91 SSVAREIFKEQELNFSSRPEFGSAEYFKYRGSRFVLAQY-------GDYWRFMK----------- 137

  Fly   159 NAKLYMTNLVQVSDEFLERIRIIRDPVTQEMPDDFA--------VDIRHLVIE----SICSVALN 211
              ||.||.|:.|..  ||:...||:....::.|..|        .|:....|:    .||.:|::
plant   138 --KLCMTKLLAVPQ--LEKFADIREEEKLKLVDSVAKCCREGLPCDLSSQFIKYTNNVICRMAMS 198

  Fly   212 THLGLLGEQRNNKDIQKLV---LALQDVVELGFQLDIMPAFWKYLPMP-NFKKL---MRSLDTIT 269
            |...  |.....::|::||   |.|...:.:|   |::... |.:... |.|||   |...|.: 
plant   199 TRCS--GTDNEAEEIRELVKKSLELAGKISVG---DVLGPL-KVMDFSGNGKKLVAVMEKYDLL- 256

  Fly   270 DFCYFHIGNALKRI--EEDAKA----GTLNEIGLETSLLE---------KLARFDRQTAVIIAMD 319
                      ::||  |.:|||    ||..:| |:. |||         |:.|.|.::   ..:|
plant   257 ----------VERIMKEREAKAKKKDGTRKDI-LDI-LLETYRDPTAEMKITRNDMKS---FLLD 306

  Fly   320 LLFAGADPTLVTLGGILFSLSKSPDKQARLLEEIRGILPNKDSSLTIE-NMRNLPYLRACIKEGI 383
            :..||.|.:...:...:..|...|....:|.|||..::.:|  .|..| ::.|||||||.::|.:
plant   307 VFMAGTDTSAAAMQWAMGQLINHPQAFNKLREEINNVVGSK--RLVKESDVPNLPYLRAVLRETL 369

  Fly   384 RMYPIGPGTLRRMPHDVVLSGYRVVAGTDVGIAANYQMANMEQFVPKVREFIPERWLRDESNSHL 448
            |::|..|..:|....|..::|..|.:.|.|.:.....|.:.|.:....| |||||:|  ||:...
plant   370 RLHPSAPLIIRECAEDCQVNGCLVKSKTRVLVNVYAIMRDSELWADADR-FIPERFL--ESSEEK 431

  Fly   449 VGE-----TATPFMYLPFGFGPRSCAGKRIVDMMLEIAISRLVRNF 489
            :||     ....|.|||||.|.|.|.|..:...::.|.:..||:.|
plant   432 IGEHQMQFKGQNFRYLPFGSGRRGCPGASLAMNVMHIGVGSLVQRF 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 126/467 (27%)
CYP712A1NP_181754.1 p450 9..508 CDD:299894 135/501 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.