DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12e1 and AT2G12190

DIOPT Version :9

Sequence 1:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_178922.1 Gene:AT2G12190 / 815688 AraportID:AT2G12190 Length:512 Species:Arabidopsis thaliana


Alignment Length:409 Identity:103/409 - (25%)
Similarity:169/409 - (41%) Gaps:74/409 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 GPAWGKMRTAVNPILLQPRNAKLYMTNLVQVSDEFLERIRIIR--DPVTQEMPDDFAVDIRHLVI 202
            |..|..:|..:...:|.|...:.|......|.:...:|....|  :|:.       .||..|..:
plant   125 GATWRLLRRNLTSEILHPSRVRSYSHARRWVLEILFDRFGKSRGEEPIV-------VVDHLHYAM 182

  Fly   203 ESICSVALNTHLGLLGEQRNNKDIQKLVLALQDVVELGFQ----LDIMPAFWKYLPMPNFKK--- 260
            .::..      |...|::.:.|.| |.|..:|....|||.    |::.|.|.|.:....:::   
plant   183 FALLV------LMCFGDKLDEKQI-KQVEYVQRRQLLGFSRFNILNLWPKFTKLILRKRWEEFFQ 240

  Fly   261 -----------LMRSLDTITDFCYFHIGNALKRIEEDAKAGTLNEIG--LETSLLEKLARFDRQT 312
                       |:|:...|.:    ...|.....|||.|....:.:.  ||..|.::..:.:...
plant   241 MRREQHDVLLPLIRARRKIVE----ERKNRSSEEEEDNKVYVQSYVDTLLELELPDEKRKLNEDE 301

  Fly   313 AVIIAMDLLFAGADPTLVTLGGILFSLSKSPDKQARLLEEIRGILPNKDSSLTIENMRNLPYLRA 377
            .|.:..:.|..|.|.|...|..|:.:|.|:|:.|.||.|||:.::..:...:..|:.:.:|||:|
plant   302 IVSLCSEFLNGGTDTTATALQWIMANLVKNPEIQKRLYEEIKSVVGEEAKEVEEEDAQKMPYLKA 366

  Fly   378 CIKEGIRMYPIGPGTLRRMPH----DVVLSGYRV-VAGTDVGIAANYQMANMEQFVPKVRE---- 433
            .:.||:|.:|.|...|   ||    |.||.||:| ..||     .|:.:|.:.: .|.|.|    
plant   367 VVMEGLRRHPPGHFVL---PHSVTEDTVLGGYKVPKKGT-----INFMVAEIGR-DPMVWEEPMA 422

  Fly   434 FIPERWLRDESNSHLVGETATPFMYLPFGFGPRSCAGKRIVDMMLEIAISRLVRNF--------- 489
            |.|||::.:|....:.|......|  |||.|.|.|.|..:..:.||..::.:||.|         
plant   423 FKPERFMGEEEAVDITGSRGIKMM--PFGAGRRICPGIGLAMLHLEYYVANMVREFEWKEVQGHE 485

  Fly   490 -----KIGFDYPIENAFKA 503
                 |..|...::::.||
plant   486 VDLTEKFEFTVVMKHSLKA 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 103/409 (25%)
AT2G12190NP_178922.1 PLN00168 23..512 CDD:215086 103/409 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.