DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12e1 and cyp26b1

DIOPT Version :9

Sequence 1:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001072655.1 Gene:cyp26b1 / 780112 XenbaseID:XB-GENE-991500 Length:511 Species:Xenopus tropicalis


Alignment Length:546 Identity:113/546 - (20%)
Similarity:210/546 - (38%) Gaps:134/546 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ISRQIYQLCRGLAQKATAVNLEEAKPYADIPGPSKLQLIRAFLPGGLYKNLPVHEMFLDMNRQ-Y 75
            :|:|::|| |..|.:..:..|...|.....|           |.|..:..:.....|....|: |
 Frog    28 VSQQLWQL-RWAATRDKSCKLPIPKGSMGFP-----------LVGETFHWILQGSDFQSSRREKY 80

  Fly    76 GSIFRMPSVAGTDLVLTMNPQDYEVIFRNE-----GQYPYRRSFEVM-----------DYFKRVH 124
            |::|: ..:.|..|:.....::...|...|     .::|  ||..::           |..:  |
 Frog    81 GNVFK-THLLGRPLIRVTGAENVRKILMGEHHLVSTEWP--RSTRMLLGPNSLANSIGDIHR--H 140

  Fly   125 RREVFDGYDGLTSGNGPAWGKMRTAVNPILLQPRNAKLYMTNLVQVSDEFLERIR-IIRDP--VT 186
            :|:||                              :|::..   :..:.:|.:|: :|:|.  |.
 Frog   141 KRKVF------------------------------SKIFSH---EALESYLPKIQLVIQDTLRVW 172

  Fly   187 QEMPDDFAV--DIRHLVIESICSVALNTHLGLLGEQRNNKDIQKLVLALQDVVELGFQLDIMPAF 249
            ...|:...|  :.:.|.......|       |||.:.:::::.:|....|..||..|.|.:    
 Frog   173 SSNPESINVYCEAQKLTFRMAIRV-------LLGFRLSDEELSQLFQVFQQFVENVFSLPV---- 226

  Fly   250 WKYLPMPNFKKLMRSLDTITDFCYFHIGNALKRIEEDAKAGTLNEIGLE-TSLLEKLARFDRQTA 313
              .:|...:::.:|:.:.:           ||.:|:..:....|..|.: ...|:.|....::..
 Frog   227 --DVPFSGYRRGIRAREML-----------LKSLEKAIQEKLQNTQGKDYADALDILIESGKEHG 278

  Fly   314 VIIAM--------DLLFAGADPTLVTLGGILFSLSKSPDKQARLLEEIRG--ILPNK---DSSLT 365
            ..:.|        :|:||....|......::..|.|.|....:|.||:||  ||.|.   :.:|.
 Frog   279 KELTMQELKDGTLELIFAAYATTASASTSLIMQLLKHPSVLEKLREELRGNSILHNGCVCEGALR 343

  Fly   366 IENMRNLPYLRACIKEGIRMYPIGPGTLRRMPHDVVLSGYRVVAGTDVGIAANYQMANMEQFVPK 430
            :|.:.:|.||...|||.:|::....|..|.:.....|.|:::..|..|    .|.:.:.....|.
 Frog   344 VETISSLHYLDCVIKEILRLFSPVSGGYRTVLQTFELDGFQIPKGWSV----LYSIRDTHDTAPV 404

  Fly   431 VRE---FIPERWLRDESNSHLVGETATPFMYLPFGFGPRSCAGKRIVDMMLEI------AISRL- 485
            .::   |.|:|:.:|.:.     :....|.|||||.|.|:|.||.:..:.|::      ::||. 
 Frog   405 FKDVDVFDPDRFGQDRTE-----DKDGRFHYLPFGGGVRNCLGKHLAKLFLKVLAIELASMSRFE 464

  Fly   486 --VRNFKIGFDYPI---ENAFKAQFF 506
              .|.|......|:   .:..|.:||
 Frog   465 LATRTFPKIMPVPVVHPADELKVRFF 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 102/495 (21%)
cyp26b1NP_001072655.1 p450 1..468 CDD:386267 107/522 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.