DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12e1 and Cyp313b1

DIOPT Version :9

Sequence 1:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster


Alignment Length:492 Identity:102/492 - (20%)
Similarity:194/492 - (39%) Gaps:91/492 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EMFLD----MNRQYGSIFRMPSVA--GTDLVLTMN-PQDYEVIFR-----NEGQYPYRRSFEVMD 118
            |.||.    ::||    |:.|.::  ||...|.:| |...|.|..     |:|.: ||.....:.
  Fly    51 ETFLQYMDGLSRQ----FKAPFISWMGTSCFLYINDPHSVEQILNSTHCTNKGDF-YRFMSSAIG 110

  Fly   119 YFKRVHRREVFDGYDGLTSGNGPAWGKMRTAVNPILLQPRNAKLYMTNLVQV----SDEFLERIR 179
                          |||.:.:.|.|.|.|..:||..     .:..::|.:.:    ::..|:::.
  Fly   111 --------------DGLFTSSSPRWHKHRRLINPAF-----GRQILSNFLPIFNAEAEVLLQKLE 156

  Fly   180 IIRDPVTQEMPDDFAVDIRHLVIESICSVALNTHLGLLGEQRNNKDIQKLVL--ALQDVVELGFQ 242
            :  :.|......:....::.:|:|:.|...       :|::.|.:....|.:  |...:.|:..:
  Fly   157 L--EGVQHGKRLEIYQILKKIVLEAACQTT-------MGKKMNFQHDGSLCIFKAYNGLTEVCVK 212

  Fly   243 LDIMPAFWKYLPMPNFKK--LMRSLDTITDFCYFHIGNALKRI--------EEDAKAGTLNEIGL 297
            ..:.|  |.| |...:::  |.|....:....:..|...|:.|        ..|.:...:...|.
  Fly   213 RMLSP--WLY-PDLIYRRSGLFRLQQKVVGILFGFIEQLLEPIVSVVAANSNPDQQRSEMEMRGK 274

  Fly   298 ETSLLEKLARFDRQTAVIIAMDL-------LFAGADPTLVTLGGILFSLSKSPDKQARLLEEIRG 355
            ..::..:..|...:...:...|:       :.|..:.|...|...:..|:..|..|.:|.:|:..
  Fly   275 SKAIFIEQVREHVERGQLSWQDVRDEANVTIAATFETTSTALYFTILCLAMHPCYQEKLHKELVT 339

  Fly   356 ILPNKDSSLTIENMRNLPYLRACIKEGIRMYPIGPGTLRRMPHDVVL----SGYRVVAGTDVGIA 416
            .|| ....:.:|.::.|.|....|.|.:|::...|..||....|:.|    ..:.:..||.:||.
  Fly   340 ELP-PSGDINLEQLQRLEYTEMVINEAMRLFAPVPMVLRSADQDIQLKRGDGEFLIPRGTQIGID 403

  Fly   417 ANYQMANMEQ-FVPKVREFIPE-RWLRDESNSHLVGETATPFMYLPFGFGPRSCAGKRIVDMMLE 479
            . |.|...|: :.|..|.:.|: .:..|....|       .|.::||..|.|.|.|.|...|:::
  Fly   404 I-YNMQRDERVWGPLSRTYNPDAHFGLDSPQRH-------AFAFVPFTKGLRMCIGYRYAQMLMK 460

  Fly   480 IAISRLVRNFKIGFDYPIENAFKAQFFVQPNIPFKFK 516
            :.::|:.|:::|..:..:|     :..|:.||..|.|
  Fly   461 LLLARIFRSYRISTEARLE-----ELLVKGNISLKLK 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 102/492 (21%)
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 96/467 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442750
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.