DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12e1 and Cyp6a2

DIOPT Version :9

Sequence 1:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster


Alignment Length:503 Identity:118/503 - (23%)
Similarity:198/503 - (39%) Gaps:113/503 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DIPGPSKLQLIRAFLPGGLYKNLPVHEMFLDMNRQY--------GSIF-RMPS--VAGTDLVLTM 93
            |.|.|....::      |..||..:|:.|.|...:|        |..| ..|:  :..|.|...:
  Fly    34 DAPHPLYGNMV------GFRKNRVMHDFFYDYYNKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNI 92

  Fly    94 NPQDYEVIFRNEGQYPYRRSFEVMDYFKRVHRREVFDGYDGLTSG----NGPAWGKMRTAVNPIL 154
            ..:|:. .|.:.||:...|.                   |.||..    :|..|..||..:.|..
  Fly    93 LIKDFS-NFADRGQFHNGRD-------------------DPLTQHLFNLDGKKWKDMRQRLTPTF 137

  Fly   155 LQPRNAKLYMTNLVQVSDEFLERIRIIRDPVTQEMP---DDFAVDIRHLVIESICSVALNTHLGL 216
            ...: .|.....:::||:||::       .:|:::|   :...::|:.|:......|......|:
  Fly   138 TSGK-MKFMFPTVIKVSEEFVK-------VITEQVPAAQNGAVLEIKELMARFTTDVIGTCAFGI 194

  Fly   217 LGEQRNNKDIQKLVLALQDVVELGFQLDIMPAFWKYLPM--PNFKKL-----MRSLDTITDFCYF 274
                    :...|...:.|...:|.::.......|.|.|  .:|.||     ||.:.......:.
  Fly   195 --------ECNTLRTPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKLASRLRMRMMPEDVHQFFM 251

  Fly   275 HIGN---ALKRIEEDAKAGTLNEIGLETSLLEKLARFDRQT----AVIIAMDL----------LF 322
            .:.|   ||:..|...:...:|       ||.:|.:..|.|    .||..||:          ..
  Fly   252 RLVNDTIALRERENFKRNDFMN-------LLIELKQKGRVTLDNGEVIEGMDIGELAAQVFVFYV 309

  Fly   323 AGADPTLVTLGGILFSLSKSPDKQARLLEEIRGILPNKDSSLTIENMRNLPYLRACIKEGIRMYP 387
            ||.:.:..|:...|:.|:::.|.|.||..||:.:|..::..||.|:::.:.||...|.|.:|:|.
  Fly   310 AGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIKAMTYLNQVISETLRLYT 374

  Fly   388 IGPGTLRRMPHDVVLSGYR---VVAGTDVGI-AANYQ-----MANMEQFVPKVREFIPERWLRDE 443
            :.|...|:..:|.|:.|:.   :..||.|.| |..|.     ..|.|.|.|:  .|.||:....|
  Fly   375 LVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNPETFDPE--RFSPEKVAARE 437

  Fly   444 SNSHLVGETATPFMYLPFGFGPRSCAGKRIVDMMLEIAISRLVRNFKI 491
            |           ..:||||.|||:|.|.|...|...|.:::::..|::
  Fly   438 S-----------VEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRV 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 112/480 (23%)
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 117/501 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.