DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12e1 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:507 Identity:108/507 - (21%)
Similarity:200/507 - (39%) Gaps:103/507 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LDMNRQYGSIFRMP--SVAGTDLVLTM-NPQDYEVIFRNEGQYPYRRSFEVMDYFKRVHRREVFD 130
            |:...||...|:.|  .:.||.::|.: :|...|.:.         .:.|.:|      :..:.|
  Fly    58 LEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVL---------NAPECLD------KTFLQD 107

  Fly   131 GY---DGLTSGNGPAWGKMRTAVNPILLQPRNAKLY-MTNLV--QVSDEFLERIRIIRDPVTQEM 189
            |:   .||....|..|...|..:||.......|..: :.|.|  |:.::|..:..:....|....
  Fly   108 GFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTA 172

  Fly   190 PDDFAVDIRHLVIESICSVALNTHLGLLGEQRN--NKDIQKLVLALQDVVELGFQLDIMPAFW-- 250
            .:|.   :...|:|..|       |.::|...|  ..|...:..:.:.::|:.....:.|  |  
  Fly   173 AEDL---LSRAVLEVSC-------LTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKP--WLQ 225

  Fly   251 -----KYLPMPNFKKLMRSLDTITDFCYFHIGNALK---------------RIEEDAKAGTLNEI 295
                 :.|....:::..:....:.||    :|..::               :..|||..|....|
  Fly   226 IRLLHRLLAPELYEESKKCAKLLEDF----VGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRI 286

  Fly   296 GLE---------TSLLEKLARFDRQTAVIIAMDLLFAGADPTLVTLGGILFSLSKSPDKQARLLE 351
            .:|         ...||::.. :.|:.|:::.:.:     ...:.|..:..:.:|. |.|.|||.
  Fly   287 FIEQIFQLAANGEMTLEEIMD-EAQSMVLVSFETV-----SNSIMLALLCLATNKG-DCQRRLLA 344

  Fly   352 EIRGILPNKDSSLTIENMRNLPYLRACIKEGIRMYPIGPGTLRRMPHDVVLSGYR---VVAGTDV 413
            |||.::|:. ..:.:|.::.|.||.|.:.|.:|:....|..||.:..|..|:|.:   :|....:
  Fly   345 EIRALVPDV-GQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSI 408

  Fly   414 GIAANYQMANMEQ-FVPKVREFIPERWLRDESNSHLVGETAT-------------PFMYLPFGFG 464
            .:...:.|...|: :....|:|.|:|:|..|......|...:             .:.:|||..|
  Fly   409 VVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNG 473

  Fly   465 PRSCAGKRIVDMMLEIAISRLVRNFKIGFDYPIENAFKAQFFVQPNIPFKFK 516
            .|||.|:|....::::.:.:|:.||....|:.:|   |.||.  .||..|||
  Fly   474 LRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELE---KLQFV--ENISLKFK 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 108/507 (21%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 98/483 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442751
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.