DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6345 and CG6550

DIOPT Version :9

Sequence 1:NP_650002.1 Gene:CG6345 / 41271 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_611207.1 Gene:CG6550 / 36954 FlyBaseID:FBgn0034214 Length:552 Species:Drosophila melanogaster


Alignment Length:514 Identity:125/514 - (24%)
Similarity:231/514 - (44%) Gaps:80/514 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KPASRLKTDEEEHVDTSVPYLNSIDFNGNGRKVHFEVYGCQMNTNDTEVVFSILKENGYLRCQEP 126
            |..|:::.:.:|..:...|.::.....|. :||..:.:||..|.:|:|.:...|...|| |....
  Fly    42 KKRSQIRLESQEEEEKPKPTIHESVIPGT-QKVFVKTWGCAHNNSDSEYMAGQLAAYGY-RLSGK 104

  Fly   127 EEADVIMLVTCAVRDGAEQRIRNRLKHLRAMKNKRSTRRHPLQLTLLGCMAERLKEK-------- 183
            ||||:.:|.:|.|::.:|...||.::         |..|:...:.:.||:.:...:.        
  Fly   105 EEADLWLLNSCTVKNPSEDTFRNEIE---------SGMRNGKHVVVAGCVPQGAPKSDYLNGLSV 160

  Fly   184 --LLEQEQCVDVIAGPDSYKDLPRLLAISRHYGNSAINVLLSLDETYADVMPVRLNSESP-TAFV 245
              :.:.::.|:|:........:..|....:.:|.......|||.:       ||.|   | ...:
  Fly   161 IGVQQIDRVVEVVEETLKGHSVQLLQNKKKVHGRRVAGAPLSLPK-------VRKN---PLIEII 215

  Fly   246 SIMRGCDNMCTYCIVPFTRGRERSRPLASIVAEVKALAEQGVKEVTLLGQNVNSY-RDRTAQEEQ 309
            ||..||.|.||||.....||...|.|...:|...:....:|..|:.|..::..:| ||.      
  Fly   216 SINSGCLNQCTYCKTKHARGDLASYPPEEVVERARQSFAEGCCEIWLTSEDTGAYGRDI------ 274

  Fly   310 DSLKATPVPGFSTVYKPKTGGTPFAALLRSVAQAVPD---MRIRFTS-PHPKDFSDEVLEVIRDH 370
                                |:....||..:.:.:|:   :|:..|: |:..:..:||..|:: |
  Fly   275 --------------------GSSLPELLWQLVEVIPEHCMLRVGMTNPPYILEHLEEVANVLQ-H 318

  Fly   371 PNVCKQLHLPAQSGNTQVLERMRRGYSREAYLELVQHIRQFLPNVGLSSDFICGFCGETEEEFQD 435
            |.|...||:|.|||:..||..|:|.|.|:.:..:|..:|:.:|.|.:::|.||||..|||::|::
  Fly   319 PRVYSFLHVPVQSGSDSVLGEMKREYCRQDFEHVVDFLRERVPGVTIATDIICGFPTETEDDFEE 383

  Fly   436 TVSLIQQVQYNVAYLFAYSMREKTTAHRRYKDDVPINVKNERLQRMVQVFREGATQLHRKMEGQE 500
            |::|..:.::...::..:..|..|.|.:  .|.:|.|:..:|.:|:..:|.  :.:.:....|:.
  Fly   384 TMTLCAKYRFPSLFINQFFPRPGTPAAK--MDRIPANLVKKRTKRLTDLFY--SYEPYADRVGEI 444

  Fly   501 QLILIEGKSKRSDAHWFGRNDANIKVIVP--------SIYVPISGDSTARKSFGVGDFL 551
            ..:|:...| ....|:.|.|.:..:|::|        .::|.|   ::|.|...||:.|
  Fly   445 YTVLVTEVS-HDKLHYVGHNKSYEQVLLPMRDNLLGTRVHVRI---TSASKFSMVGEIL 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 121/488 (25%)
UPF0004 93..196 CDD:279287 27/112 (24%)
TRAM 494..568 CDD:280171 15/66 (23%)
CG6550NP_611207.1 MiaB-like-B 72..549 CDD:273703 120/483 (25%)
UPF0004 72..151 CDD:279287 25/88 (28%)
Radical_SAM 215..413 CDD:100105 63/226 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438657
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0621
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407532at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.