powered by:
Protein Alignment CG6345 and Cdkal1
DIOPT Version :9
Sequence 1: | NP_650002.1 |
Gene: | CG6345 / 41271 |
FlyBaseID: | FBgn0037816 |
Length: | 583 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001101883.1 |
Gene: | Cdkal1 / 361243 |
RGDID: | 1310246 |
Length: | 133 |
Species: | Rattus norvegicus |
Alignment Length: | 45 |
Identity: | 11/45 - (24%) |
Similarity: | 20/45 - (44%) |
Gaps: | 9/45 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 DTSVPYLNSIDFNGNGRKVHFEVYGCQMNTNDTEVVFSILKENGY 120
|:::|.: :|:....:||..|.:|.|.:...|...||
Rat 56 DSTIPGI---------QKIWIRTWGCSHNNSDGEYMAGQLAAYGY 91
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D407532at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.920 |
|
Return to query results.
Submit another query.