DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6345 and Cdkal1

DIOPT Version :9

Sequence 1:NP_650002.1 Gene:CG6345 / 41271 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001101883.1 Gene:Cdkal1 / 361243 RGDID:1310246 Length:133 Species:Rattus norvegicus


Alignment Length:45 Identity:11/45 - (24%)
Similarity:20/45 - (44%) Gaps:9/45 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DTSVPYLNSIDFNGNGRKVHFEVYGCQMNTNDTEVVFSILKENGY 120
            |:::|.:         :|:....:||..|.:|.|.:...|...||
  Rat    56 DSTIPGI---------QKIWIRTWGCSHNNSDGEYMAGQLAAYGY 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 9/33 (27%)
UPF0004 93..196 CDD:279287 9/28 (32%)
TRAM 494..568 CDD:280171
Cdkal1NP_001101883.1 UPF0004 64..>94 CDD:334313 9/28 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407532at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.