DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp46 and MTR3

DIOPT Version :9

Sequence 1:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_011674.3 Gene:MTR3 / 853062 SGDID:S000003390 Length:250 Species:Saccharomyces cerevisiae


Alignment Length:114 Identity:25/114 - (21%)
Similarity:49/114 - (42%) Gaps:20/114 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKDKLRQMHCEFNPLSRCDGSVMYSQGA----TGLIGAVLGPIEVKTQNLSIDGSYLE---CNYR 67
            |.::...:|..|  :..|:||.:....:    |.||.||.||       .||.||:..   .:.:
Yeast    41 ESEQELSLHTGF--IENCNGSALVEARSLGHQTSLITAVYGP-------RSIRGSFTSQGTISIQ 96

  Fly    68 PKAGLPQV--TDRIREAA--IRDVLELALLSEAHPRSKMSVQIQELEDR 112
            .|.||.:.  |:.::|.:  :..:....:....:|:|.:.:.:....|:
Yeast    97 LKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp46NP_650001.2 Rph 10..215 CDD:223761 25/114 (22%)
RNase_PH_RRP46 14..211 CDD:206777 24/110 (22%)
MTR3NP_011674.3 Rph 13..246 CDD:223761 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.