DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp46 and AT3G46210

DIOPT Version :9

Sequence 1:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001030817.1 Gene:AT3G46210 / 823766 AraportID:AT3G46210 Length:239 Species:Arabidopsis thaliana


Alignment Length:232 Identity:62/232 - (26%)
Similarity:112/232 - (48%) Gaps:31/232 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MDVEKD------KLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEVKTQNLSIDGSYLECN 65
            |:::::      :||.:.|..|.|.|..||..:|||.|.::.||.||.....:|.:.:.:..|..
plant     1 MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNENAEKACFEVI 65

  Fly    66 YRPKAGLPQVTDRIREAAIRDVLELALLSEAHPRSKMSVQIQELEDRGSIDACAVNCACLAMLIG 130
            ::||:|.....::..|..::..::...:...:|.:..||.||.:.|.||:..||:|.||.|::..
plant    66 WKPKSGQIGKVEKEYEMILKRTIQSICVLTVNPNTTTSVIIQVVHDDGSLLPCAINAACAALVDA 130

  Fly   131 GLPLKYSFAAVHAIINEQGEYVLDPDQSETLHQRASFTFAFDSVEGNLLLIQTKGSFKIAQFNDI 195
            |:|:|:...|:...:.|.|..||||::   |.::....||:.......|.:..:|| .:|:...:
plant   131 GIPMKHLAVAICCCLAENGYLVLDPNK---LEEKKMTAFAYLVFPNTTLSVLPEGS-SVAEGEPV 191

  Fly   196 E-----------------CLCL----AASAEIFQFYR 211
            |                 .||:    ||:|.:..|:|
plant   192 EHGIITSITHGVMSVDDYFLCVENGRAATASLSAFFR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp46NP_650001.2 Rph 10..215 CDD:223761 61/229 (27%)
RNase_PH_RRP46 14..211 CDD:206777 60/217 (28%)
AT3G46210NP_001030817.1 RNase_PH_RRP46 14..228 CDD:206777 60/217 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5981
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 1 1.010 - - D1129417at2759
OrthoFinder 1 1.000 - - FOG0004463
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103234
Panther 1 1.100 - - LDO PTHR11953
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.