DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp46 and exosc6

DIOPT Version :10

Sequence 1:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001017016.1 Gene:exosc6 / 549770 XenbaseID:XB-GENE-998313 Length:270 Species:Xenopus tropicalis


Alignment Length:150 Identity:45/150 - (30%)
Similarity:69/150 - (46%) Gaps:15/150 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LSRCDGSVMYSQGATG--LIGAVLGPIE--VKTQNLSIDGSYLECNYR--------PKAGLPQVT 76
            ||:..||.....|:.|  ::.||.||.|  :..:.....|..| |:.|        |.:|.....
 Frog    50 LSQAKGSAYLEAGSGGTKVLCAVHGPRERGMGGERAETRGRLL-CDLRWAPFSRRGPWSGSCPAG 113

  Fly    77 DRIREAA--IRDVLELALLSEAHPRSKMSVQIQELEDRGSIDACAVNCACLAMLIGGLPLKYSFA 139
            ...|:|.  :::.||.|:..:.:||:::.|.:..||||||....||:||.||:...|:.:.....
 Frog   114 PSPRQAGLQLQESLEPAVRLDRYPRAEVIVWVLVLEDRGSALPAAVSCASLALADAGIEMFDLAL 178

  Fly   140 AVHAIINEQGEYVLDPDQSE 159
            .........||.:||||..|
 Frog   179 GCGLSRGPGGELLLDPDDDE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp46NP_650001.2 RNase_PH_RRP46 14..211 CDD:206777 44/149 (30%)
exosc6NP_001017016.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..42
RNase_PH_MTR3 40..256 CDD:206776 44/149 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.