DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp46 and EXOSC4

DIOPT Version :9

Sequence 1:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_061910.1 Gene:EXOSC4 / 54512 HGNCID:18189 Length:245 Species:Homo sapiens


Alignment Length:144 Identity:39/144 - (27%)
Similarity:63/144 - (43%) Gaps:31/144 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEVKTQNLSI--DGSYLECNY--------- 66
            :||::.......::.|||....||.|..:..|.||.|::......  |.:.:.|.|         
Human    21 ELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGE 85

  Fly    67 ---RP-------KAGLPQVTDRIREAAIRDVLELALLSEAHPRSKMSVQIQELEDRGSIDACAVN 121
               ||       :.||          .:|...|.|:|::.||||::.:.:|.|:..|...|..||
Human    86 RKRRPHGDRKSCEMGL----------QLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVN 140

  Fly   122 CACLAMLIGGLPLK 135
            .|.||:|..|:|::
Human   141 AATLAVLDAGIPMR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp46NP_650001.2 Rph 10..215 CDD:223761 39/144 (27%)
RNase_PH_RRP46 14..211 CDD:206777 39/143 (27%)
EXOSC4NP_061910.1 RNase_PH_RRP41 11..237 CDD:206775 39/144 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.