DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp46 and exosc4

DIOPT Version :9

Sequence 1:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_957033.1 Gene:exosc4 / 393712 ZFINID:ZDB-GENE-040426-1702 Length:245 Species:Danio rerio


Alignment Length:239 Identity:59/239 - (24%)
Similarity:107/239 - (44%) Gaps:42/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMDVEK-DKLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEVK-TQNLSI-DGSYLECNY- 66
            ::|..| .:||::....:..::.|||....||.|..:..|.||.|:: :::.|: |.:.:.|.| 
Zfish    13 RLDGRKATELRKVQARMSVFAQADGSAYLEQGNTKALAVVYGPHEIRGSRSKSLHDRAIINCQYS 77

  Fly    67 -----------RPKAGLPQVTDRIREAA---IRDVLELALLSEAHPRSKMSVQIQELE-DRGSID 116
                       ||..      ||.....   ::...|.|:|:|.:|||::.:.::.|: |.|:..
Zfish    78 MATFSTAERKRRPHG------DRKSSEMSLHLKQTFEAAVLTELYPRSQIDIYVKILQADGGNYS 136

  Fly   117 ACAVNCACLAMLIGGLPLKYSFAAVHAIINEQGEYVLDPDQSETLHQRAS-----FTFAFDSVEG 176
            || ||.|.||::..|:|::....|..|      .:|.|...::..|...|     ...|.....|
Zfish   137 AC-VNAATLALVDAGIPMRDYVCACSA------GFVEDTPLADLCHAEESGGGTALALALLPRSG 194

  Fly   177 NLLLIQTKGSFKIAQFNDIECLCLAASAEIFQFYR--NQVAKYH 218
            |:.|:|...  ::.| :.::.|..||.....:|.:  :.|.:.|
Zfish   195 NIALLQMDA--RLHQ-DHLDTLMEAAMTACKEFSKVLDSVVRQH 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp46NP_650001.2 Rph 10..215 CDD:223761 56/230 (24%)
RNase_PH_RRP46 14..211 CDD:206777 55/219 (25%)
exosc4NP_957033.1 PRK03983 1..227 CDD:235187 57/229 (25%)
RNase_PH_RRP41 11..237 CDD:206775 59/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.