DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp46 and Ski6

DIOPT Version :9

Sequence 1:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001260437.1 Gene:Ski6 / 34721 FlyBaseID:FBgn0032487 Length:246 Species:Drosophila melanogaster


Alignment Length:206 Identity:49/206 - (23%)
Similarity:87/206 - (42%) Gaps:18/206 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEVKTQNLSIDGSYLECNY----------- 66
            :||::.|:.....:.|||....||.|.::.||.||.:.|.....   |.:.|.|           
  Fly    22 ELRRIKCKLGVFEQPDGSAYMEQGNTKVLAAVYGPHQAKGNQTE---SVINCQYSQATFSTAERK 83

  Fly    67 -RPKAGLPQVTDRIREAAIRDVLELALLSEAHPRSKMSVQIQELEDRGSIDACAVNCACLAMLIG 130
             ||:.....:..::   .::..|..|:.||.:|||::.:.::.|:|.|:..|.|:|.|.||::..
  Fly    84 NRPRGDRKSLEFKL---YLQQALSAAIKSELYPRSQIDIYVEVLQDDGANYAVALNAATLALIDA 145

  Fly   131 GLPLKYSFAAVHAIINEQGEYVLDPDQSETLHQRASFTFAFDSVEGNLLLIQTKGSFKIAQFNDI 195
            |:.|.....|..|.:::....:.|..|.|.:......|.|.......:..::....|.|.....:
  Fly   146 GICLNEFIVACTASLSKSNIPLTDISQFEEVSGGPKLTVAALPTAEKIAFLEMSERFHIDHLETV 210

  Fly   196 ECLCLAASAEI 206
            ....:|...||
  Fly   211 IETAMAGCREI 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp46NP_650001.2 Rph 10..215 CDD:223761 49/206 (24%)
RNase_PH_RRP46 14..211 CDD:206777 49/205 (24%)
Ski6NP_001260437.1 PRK03983 7..231 CDD:235187 49/206 (24%)
RNase_PH_RRP41 12..233 CDD:206775 49/206 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456997
Domainoid 1 1.000 43 1.000 Domainoid score I745
eggNOG 1 0.900 - - E1_COG0689
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.