DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp46 and Exosc6

DIOPT Version :9

Sequence 1:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_006255676.1 Gene:Exosc6 / 307850 RGDID:1309832 Length:312 Species:Rattus norvegicus


Alignment Length:191 Identity:53/191 - (27%)
Similarity:83/191 - (43%) Gaps:28/191 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PAKMDVEKDKLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEVK-------------TQNL 55
            ||..|  ..:||.::.....||:..||.....|.|.::.||.||.:.:             ....
  Rat    68 PAARD--PTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGGGPAGAGGEAPA 130

  Fly    56 SIDGSYLECNYR--PKAG----LPQVTDRIRE--AAIRDVLELALLSEAHPRSKMSVQIQELEDR 112
            ::.|..| |::|  |.:|    .||.:...||  .|:::.||.|:....:||:::.|....|||.
  Rat   131 ALRGRLL-CDFRRAPFSGRRRRAPQGSSEDRELGLALQEALEPAVRLGRYPRAQLEVSALLLEDG 194

  Fly   113 GSIDACAVNCACLAMLIGGLPLKYSFAAVHAIINEQG---EYVLDPDQSETLHQRASFTFA 170
            ||..|.|:..|.||:...|:.: |.......:....|   .::|||.:.|..|..|..|.|
  Rat   195 GSALAAALTAAALALADAGVEM-YDLVVGCGLSLTPGPSPTWLLDPTRLEEEHSEAGLTVA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp46NP_650001.2 Rph 10..215 CDD:223761 50/185 (27%)
RNase_PH_RRP46 14..211 CDD:206777 50/181 (28%)
Exosc6XP_006255676.1 ECX1 71..299 CDD:131120 51/188 (27%)
RNase_PH_MTR3 76..300 CDD:206776 50/181 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.