DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp46 and Exosc5

DIOPT Version :9

Sequence 1:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_613052.1 Gene:Exosc5 / 27998 MGIID:107889 Length:235 Species:Mus musculus


Alignment Length:208 Identity:80/208 - (38%)
Similarity:114/208 - (54%) Gaps:0/208 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEVKTQNLSIDGSYLECNYRPKAGLPQVTDR 78
            ||...||.|.|||.|||..:.||.|.::..|.||.|||......:.:.||...|||.|||.|.::
Mouse    28 LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLPGVAEK 92

  Fly    79 IREAAIRDVLELALLSEAHPRSKMSVQIQELEDRGSIDACAVNCACLAMLIGGLPLKYSFAAVHA 143
            .||..:|:..|..:|...|||:.::|.:|.:.|.||:.||.:|.||:|::..|:|::..|..|..
Mouse    93 SRERLVRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVPMRALFCGVTC 157

  Fly   144 IINEQGEYVLDPDQSETLHQRASFTFAFDSVEGNLLLIQTKGSFKIAQFNDIECLCLAASAEIFQ 208
            .::..|..||||...:....||..|||.||.|..||:..|||.:..|:.........|||..||:
Mouse   158 ALDSDGNLVLDPTTKQEKEARAILTFALDSAEQKLLMSTTKGLYSDAELQQCLAAAQAASQHIFR 222

  Fly   209 FYRNQVAKYHGRS 221
            |||..:.:.:.:|
Mouse   223 FYRESLQRRYSKS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp46NP_650001.2 Rph 10..215 CDD:223761 79/200 (40%)
RNase_PH_RRP46 14..211 CDD:206777 77/196 (39%)
Exosc5NP_613052.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
ECX1 11..232 CDD:131120 79/203 (39%)
RNase_PH_RRP46 28..225 CDD:206777 77/196 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842488
Domainoid 1 1.000 100 1.000 Domainoid score I7045
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5981
Inparanoid 1 1.050 152 1.000 Inparanoid score I4338
Isobase 1 0.950 - 0 Normalized mean entropy S2213
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004463
OrthoInspector 1 1.000 - - oto91944
orthoMCL 1 0.900 - - OOG6_103234
Panther 1 1.100 - - LDO PTHR11953
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1221
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.