DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp46 and exos-4.2

DIOPT Version :9

Sequence 1:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001380008.1 Gene:exos-4.2 / 259488 WormBaseID:WBGene00000202 Length:241 Species:Caenorhabditis elegans


Alignment Length:177 Identity:44/177 - (24%)
Similarity:77/177 - (43%) Gaps:19/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMDVEKDKLRQMHCEFNPLS-RC------DGSVMYSQGATGLIGAVLGPIEVKTQNLSIDGSYLE 63
            :|:.:.::.::.:..|.||. :|      |||.....|.|.::..:.||        ..||.:.|
 Worm    22 RMETDSEEHKRANTAFRPLCVKCGVFGAQDGSGYAEFGNTRVLAQITGP--------DGDGKWEE 78

  Fly    64 CNYRPKAGLPQVTDRIREAAIRDVLELA----LLSEAHPRSKMSVQIQELEDRGSIDACAVNCAC 124
            ...:....|..:.|.::.|..|..|..|    :.:..:|...:.::|..|.|.|.:.:.|::...
 Worm    79 DRAKITIELKGIEDSVKVAEYRAQLASAVSAVIFASKYPGKVIEIEITVLSDDGGVLSTALSAVT 143

  Fly   125 LAMLIGGLPLKYSFAAVHAIINEQGEYVLDPDQSETLHQRASFTFAF 171
            ||:...|:......|:||..:|..||.:.||..||:.......||||
 Worm   144 LAISHSGIENMGLMASVHVAMNSDGECLTDPSTSESEGAIGGVTFAF 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp46NP_650001.2 Rph 10..215 CDD:223761 43/173 (25%)
RNase_PH_RRP46 14..211 CDD:206777 43/169 (25%)
exos-4.2NP_001380008.1 RNase_PH 37..235 CDD:413593 43/162 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.