DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp46 and exos-4.1

DIOPT Version :9

Sequence 1:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001366781.1 Gene:exos-4.1 / 24105309 WormBaseID:WBGene00007201 Length:240 Species:Caenorhabditis elegans


Alignment Length:207 Identity:49/207 - (23%)
Similarity:91/207 - (43%) Gaps:14/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEVKTQNLSIDGSYLECNYRPK--AGLPQV 75
            ::|.::.........:||.....|.|.::.||.||.|.|:.....|...:.|.|...  :||.:.
 Worm    18 QIRNINTRLGLNRNAEGSCYLEHGNTKVLCAVYGPYEGKSSKRIEDKCAIVCQYSATKFSGLERK 82

  Fly    76 T----DRIREAAIRDVLELA----LLSEAHPRSKMSVQIQELEDRGSIDACAVNCACLAMLIGGL 132
            .    || :...|..:||.|    :|:||.|||::.:..:.::..||..|..||...||:...|:
 Worm    83 NRTRGDR-KSTEISRLLEKAFESVILTEAFPRSQLDIFCEVIQGDGSNLAACVNATSLALADAGI 146

  Fly   133 PLK-YSFAAVHAIINEQGEYVLDPDQSETLHQRASFTFAFDSVEGNLLLIQTKGSFKIAQFNDIE 196
            |:| .:.||...:::  |:.::|....|........|.|.......::|::.:....|...:.:.
 Worm   147 PMKGIASAATCGVVD--GKPIVDLTSREETDLLPRVTLATICGRDEVILVELQNRLHIDHLSTVM 209

  Fly   197 CLCLAASAEIFQ 208
            ....|..|::::
 Worm   210 DAAKATCADVYE 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp46NP_650001.2 Rph 10..215 CDD:223761 49/207 (24%)
RNase_PH_RRP46 14..211 CDD:206777 49/206 (24%)
exos-4.1NP_001366781.1 RNase_PH_RRP41 8..232 CDD:206775 49/207 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.