DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp46 and crn-5

DIOPT Version :9

Sequence 1:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_496284.1 Gene:crn-5 / 174634 WormBaseID:WBGene00000798 Length:214 Species:Caenorhabditis elegans


Alignment Length:216 Identity:62/216 - (28%)
Similarity:101/216 - (46%) Gaps:34/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEVKTQNLSIDGSYLECNYRPKAGLPQVTD 77
            :||:|.||.:.|...|||..:|||||.:..:..||.:|.....|.:...|:.:||...|..:.  
 Worm     4 RLREMRCELSFLKNADGSACFSQGATCIWASCSGPGDVHASKASDEAMTLDISYRANCGDNKF-- 66

  Fly    78 RIREAAIRDVLELALLSEAHPRSKMSVQIQELEDRGSIDACAVNCACLAMLIGGLPLKYSFAAVH 142
            .:....|...|..|:..|..|.:.:||.:..::|.||:.|.|:|.||.|:|..|:|.:..|..| 
 Worm    67 NVLNNIIHSTLSNAINLELFPHTTISVTVHGIQDDGSMGAVAINGACFALLDNGMPFETVFCGV- 130

  Fly   143 AIINEQGEYVLDPDQSETLHQRASFT-----------------FAFDSVEGNLLLIQTKGSFKIA 190
            .|:..:.|.::||    |..|.|:.|                 .|.|:: |:...||.:.::.:|
 Worm   131 LIVRVKDELIIDP----TAKQEAASTGRVLFSVCKGSDGHPEVCAMDAI-GHWDFIQLEAAWSLA 190

  Fly   191 QFNDIECLCLAASAEIFQFYR 211
            |         .:::.||.||:
 Worm   191 Q---------PSASAIFDFYK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp46NP_650001.2 Rph 10..215 CDD:223761 62/216 (29%)
RNase_PH_RRP46 14..211 CDD:206777 61/213 (29%)
crn-5NP_496284.1 RNase_PH_RRP46 5..202 CDD:206777 61/213 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162496
Domainoid 1 1.000 71 1.000 Domainoid score I6219
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5981
Inparanoid 1 1.050 82 1.000 Inparanoid score I3768
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 1 1.010 - - D1129417at2759
OrthoFinder 1 1.000 - - FOG0004463
OrthoInspector 1 1.000 - - oto18241
orthoMCL 1 0.900 - - OOG6_103234
Panther 1 1.100 - - LDO PTHR11953
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1221
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.