DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp46 and EXOSC6

DIOPT Version :9

Sequence 1:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_478126.1 Gene:EXOSC6 / 118460 HGNCID:19055 Length:272 Species:Homo sapiens


Alignment Length:188 Identity:49/188 - (26%)
Similarity:77/188 - (40%) Gaps:38/188 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEVK-------------TQNLSIDGSYLEC 64
            :||.::.....||:..||.....|.|.::.||.||.:.:             ....::.|..| |
Human    35 RLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGGGPAGAGGEAPAALRGRLL-C 98

  Fly    65 NYR--PKAGLPQVTDRIREA------------AIRDVLELALLSEAHPRSKMSVQIQELEDRGSI 115
            ::|  |.||      |.|.|            |:::.||.|:....:||:::.|....|||.||.
Human    99 DFRRAPFAG------RRRRAPPGGCEERELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSA 157

  Fly   116 DACAVNCACLAMLIGGLPLKYSFAAVHAIINEQG---EYVLDPDQSETLHQRASFTFA 170
            .|.|:..|.||:...|:.: |.......:....|   .::|||.:.|.....|..|.|
Human   158 LAAALTAAALALADAGVEM-YDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAGLTVA 214

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Rrp46NP_650001.2 Rph 10..215 CDD:223761 49/188 (26%)
RNase_PH_RRP46 14..211 CDD:206777 49/187 (26%)