DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp46 and exosc5

DIOPT Version :9

Sequence 1:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_002939437.3 Gene:exosc5 / 100170617 XenbaseID:XB-GENE-6257997 Length:215 Species:Xenopus tropicalis


Alignment Length:217 Identity:70/217 - (32%)
Similarity:120/217 - (55%) Gaps:4/217 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MDVEKDKLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEVKTQNLSIDGSYLECNYRPKAG 71
            |:.....||:..||.:.|||.|||..:.||.|.::..|.||.|:|......:.:.||...|||.|
 Frog     1 MEAVGSVLREYGCEQSLLSRPDGSATFLQGDTSVMAGVYGPAEIKVSREIHNKATLEVILRPKTG 65

  Fly    72 LPQVTDRIREAAIRDVLELALLSEAHPRSKMSVQIQELEDRGSIDACAVNCACLAMLIGGLPLKY 136
            ||.:.::.:|..||:..|..::...|||:.:::.:|.:.|.||:.:|.:|.||:.::..|||::.
 Frog    66 LPAIQEKNQEQLIRETCESVIIGSLHPRTSITIVLQIVSDAGSLLSCCLNAACMGLMDAGLPMRA 130

  Fly   137 SFAAVHAIINEQGEYVLDPDQSETLHQRASFTFAFDSVEGNLLLIQTKGSFKIAQFNDIECLCLA 201
            .|..|...::..|...|||:..:....||..|||.:|.|..:|::..:|.:...:..  :|:..|
 Frog   131 LFCGVTCAMDNDGTITLDPNFRQQKESRAVLTFAIESTERKVLMMSNRGVYSATELQ--QCIAAA 193

  Fly   202 --ASAEIFQFYRNQVAKYHGRS 221
              ||.::|||||:.:.:.:.:|
 Frog   194 QIASEKLFQFYRDFIRRRYSKS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp46NP_650001.2 Rph 10..215 CDD:223761 68/206 (33%)
RNase_PH_RRP46 14..211 CDD:206777 66/198 (33%)
exosc5XP_002939437.3 RNase_PH_RRP46 8..205 CDD:206777 66/198 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7465
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5981
Inparanoid 1 1.050 137 1.000 Inparanoid score I4435
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129417at2759
OrthoFinder 1 1.000 - - FOG0004463
OrthoInspector 1 1.000 - - oto102257
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.