DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rfx and Rfx5

DIOPT Version :9

Sequence 1:NP_001247023.2 Gene:Rfx / 41266 FlyBaseID:FBgn0020379 Length:919 Species:Drosophila melanogaster
Sequence 2:NP_001342634.1 Gene:Rfx5 / 53970 MGIID:1858421 Length:658 Species:Mus musculus


Alignment Length:182 Identity:56/182 - (30%)
Similarity:82/182 - (45%) Gaps:26/182 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 RVNGTNRHWVQE--VAYIQEAQSTPQTPTSTTTTHSASGGSLGTGGGGASPDSDQSALGSSNKIA 390
            |:.||....||.  ...:||.|...............||.|:|      ...|:.|.|  ||:..
Mouse    32 RLRGTISKAVQNKVEGILQEVQKFSDNDKLYLYLQLPSGPSVG------EKSSEPSLL--SNEEY 88

  Fly   391 SATIKWLSRNYETADGVSLPRSTLYNHYMQHC-SEHKLEPVNAASFGKLIRSVFSGLRTRRLGTR 454
            ....:|:..:.|......||:.::|:.|.::| |.....|::.|:|||:||.:|..::.||||.|
Mouse    89 MYAYRWIRNHLEEHMDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGR 153

  Fly   455 GNSKYHYYGIRIKPGSLLNSQAMDDKQMLAAGYGPSSD--GTGGPGSGPMVS 504
            |.|||.|.|||.|  :|::...:           |..|  |:..|..||.||
Mouse   154 GQSKYCYSGIRRK--TLVSMPPL-----------PGLDLKGSESPEMGPEVS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfxNP_001247023.2 RFX_DNA_binding 393..466 CDD:280427 28/73 (38%)
Rfx5NP_001342634.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
N-terminal domain. /evidence=ECO:0000250 24..89 17/64 (27%)
RFX5_N 27..85 CDD:375753 15/60 (25%)
Leucine-rich region, critical for dimer formation and for interaction with RFXAP. /evidence=ECO:0000250 61..65 0/3 (0%)
RFX_DNA_binding 89..165 CDD:367002 28/75 (37%)
PxLPxI/L motif, mediates interaction with RFXANK. /evidence=ECO:0000250|UniProtKB:P48382 172..177 1/15 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..315
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..422
RFX5_DNA_bdg 442..656 CDD:373167
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..602
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 624..658
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.