DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rfx and Rfx4

DIOPT Version :9

Sequence 1:NP_001247023.2 Gene:Rfx / 41266 FlyBaseID:FBgn0020379 Length:919 Species:Drosophila melanogaster
Sequence 2:XP_038936002.1 Gene:Rfx4 / 500818 RGDID:1562092 Length:757 Species:Rattus norvegicus


Alignment Length:601 Identity:193/601 - (32%)
Similarity:276/601 - (45%) Gaps:126/601 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 SHGRDSPHSLTVSSRDWERDADRVNGTNRHWVQEVAYIQEAQSTPQTPTSTTT-----------T 359
            :.||:        .|||||...:.      |.::..|   .|..|..|.||.:           .
  Rat     3 NQGRE--------KRDWERMESKA------WARDGGY---RQRRPWQPHSTESWIERCLNESENK 50

  Fly   360 HSASGGSLGTGGGGASPDSDQSALGSSNKIAS-----ATIKWLSRNYETADGVSLPRSTLYNHYM 419
            ..:|..|||      :..:|::....:|:.:.     ||::||..|||.|:||.:|||.||.||:
  Rat    51 RYSSHTSLG------NVSNDENEEKENNRASKPHSTPATLQWLEENYEIAEGVCIPRSALYMHYL 109

  Fly   420 QHCSEHKLEPVNAASFGKLIRSVFSGLRTRRLGTRGNSKYHYYGIRIKPGSLLNSQAMDDKQMLA 484
            ..|.::..:|||||||||:||..|..|.||||||||.||||||||.:|..|          |...
  Rat   110 DFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESS----------QYYD 164

  Fly   485 AGYGPSSDGTGGPGSGPMVSVTSSTAGQLTGSNGLGGGHGQRHSNGTKKHTFKPETYEACIQYIG 549
            ..|  |..|...........||..|.           .:..|...||                  
  Rat   165 VMY--SKKGAAWVSETGKREVTKQTV-----------AYSPRSKLGT------------------ 198

  Fly   550 DGTSALPSFPPI-ELNHSFNSELTLEDVDTFRGLYREHCESFLDAVLNLEFNTVEFLLRDFWRAS 613
                .||.||.: :||  ..:.|..|.|.||..:||.||:..||.|:...|:.|:..|..||:..
  Rat   199 ----LLPDFPNVKDLN--LPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGM 257

  Fly   614 DNNNLDECEEEKYLSKTKLYLLCHCAEVQKFVREVDYQFYQNTVDVIIPDVLRSIPNALTQAIRN 678
            ..:.|.               :...:.|...|...|...|:....|::|.||:::|::|||.||.
  Rat   258 PPHMLP---------------VLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRK 307

  Fly   679 FAKNLEIWLCESMLGVPEQLAQIKTSAVSAFCQTLRRYTSLNHLAQAARAVLQNGAQISQMLSDL 743
            |||.|:.||..::..:||.|..||......|.|.|||.||||||.||:|.|:.:.....|||.|.
  Rat   308 FAKQLDEWLKVALHDLPENLRNIKFELSRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDW 372

  Fly   744 NRVDFHNVQEQAAWVSQCA----PAVVQRLESDFKAALQQQSSLEQWASWLQLVVESAMEEYNGK 804
            ..||..::.:|..:..:.:    ..::.:|..:|...|::||.:|.:..||..:|:..:.:...|
  Rat   373 RNVDLSSITKQTLYTMEDSRDEHRRLIIQLYQEFDHLLEEQSPIESYIEWLDTMVDRCVVKVAAK 437

  Fly   805 --PTYARAARQFLLKWSFYSSMIIRDLTLRSASSFGSFHLIRLLFDEYMFYLVEH---------- 857
              .:..:.|:||||.||.:.:.:|||:||.||.||||||||.|:||:|:.||:|.          
  Rat   438 RQGSLKKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESLHCQERANEL 502

  Fly   858 --------KIAEAQDK 865
                    ..||||::
  Rat   503 MRAMKGEGSTAEAQEE 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfxNP_001247023.2 RFX_DNA_binding 393..466 CDD:280427 46/72 (64%)
Rfx4XP_038936002.1 RFX_DNA_binding 81..156 CDD:396712 47/74 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D278246at33208
OrthoFinder 1 1.000 - - FOG0000699
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X291
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.