DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and FOXN1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_011523660.1 Gene:FOXN1 / 8456 HGNCID:12765 Length:649 Species:Homo sapiens


Alignment Length:431 Identity:133/431 - (30%)
Similarity:173/431 - (40%) Gaps:111/431 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 PKKNKTASSTQGRSGAVPSSPSAERDQHKSHLTFSPAQMKVSAGSMRR----------------D 195
            |...:.....||.....|..|.:...|.| |..||.:.. ||.|...|                :
Human    14 PGPTRLEGERQGDLMQAPGLPGSPAPQSK-HAGFSCSSF-VSDGPPERTPSLPPHSPRIASPGPE 76

  Fly   196 QVMAHIP----------KQISVVTGTGTTAPATMATNSVLQRRNSSAVDAVR---KDLVTELR-- 245
            ||..|.|          .......|.|....|..:....|:..::......|   :|:..|..  
Human    77 QVQGHCPAGPGPGPFRLSPSDKYPGFGFEEAAASSPGRFLKGSHAPFHPYKRPFHEDVFPEAETT 141

  Fly   246 ---KAQSSPVPNSLEELGKGKGSTLLNASVGATNTIKLAPGIGGLTFANSAAY-------QKLKQ 300
               |..|...|..||...:        ..|.........||.....:.|...|       |.|:.
Human   142 LALKGHSFKTPGPLEAFEE--------IPVDVAEAEAFLPGFSAEAWCNGLPYPSQEHGPQVLQG 198

  Fly   301 TSLVKSPGGISPGAGSNMGLKREDSNKRGLQASTTP-KSIASAANSPHHQMQSNYSLGSPS---- 360
            :.:...|..:..||              |:.....| :.:..::..|.||    ||.|..|    
Human   199 SEVKVKPPVLESGA--------------GMFCYQPPLQHMYCSSQPPFHQ----YSPGGGSYPIP 245

  Fly   361 SLSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLPPVGSP------FPKPAYSYSCL 419
            .|.||.                              .|..::.|..|.      ||||.||||.|
Human   246 YLGSSH------------------------------YQYQRMAPQASTDGHQPLFPKPIYSYSIL 280

  Fly   420 IALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKG 484
            |.:|||||:.|||||||||:|:.:|||||:.||.||||||||||||||||||:|. .:..:.|||
Human   281 IFMALKNSKTGSLPVSEIYNFMTEHFPYFKTAPDGWKNSVRHNLSLNKCFEKVEN-KSGSSSRKG 344

  Fly   485 CRWAMNPDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLESL 525
            |.||:||.:|:||.||:|||.||||.|:|.:|..|:.|:||
Human   345 CLWALNPAKIDKMQEELQKWKRKDPIAVRKSMAKPEELDSL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 60/87 (69%)
FOXN1XP_011523660.1 Forkhead 272..359 CDD:278670 60/87 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159591
Domainoid 1 1.000 139 1.000 Domainoid score I4800
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41589
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2111
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.