DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxj3

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001313317.1 Gene:foxj3 / 797147 ZFINID:ZDB-GENE-101005-1 Length:596 Species:Danio rerio


Alignment Length:354 Identity:92/354 - (25%)
Similarity:139/354 - (39%) Gaps:95/354 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 NTSGAG----SGLVKPL----QQKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSF 440
            |..|.|    |.|:.|.    |::|:....|    ||.|||:.||..|:.:|....:.:||||.:
Zfish    31 NAHGPGMPKKSALLDPNTTLDQEEVQQHKDG----KPPYSYASLITFAINSSPKKKMTLSEIYQW 91

  Fly   441 LCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQKWS 505
            :|.:|||:..|.||||||:||||||||||.|:  |.:..:..||..||::   .|..::.:....
Zfish    92 ICDNFPYYREAGSGWKNSIRHNLSLNKCFLKV--PRSKDDPGKGSYWAID---TNPKEDTLPTRP 151

  Fly   506 RKDPAAIRGAMVYPQHLESLERGE--MKHGSADSDVELDSQSEIEESSDLEEHEFEDTMVDAMLV 568
            :|.|.:...|.. |..|||...|.  :..|||...:.:                  :|:.:.:.:
Zfish   152 KKRPRSGERAST-PYSLESDNLGMDCIISGSASPTLAI------------------NTVTNKVAL 197

  Fly   569 EEEDEEEDGDDDEQIINDFDAEDERHANGNQANNLPINHPLLGQKSNDFDIEVGDLYDAIDIEDD 633
            ...|  :||.|..:               :..||...:..|.....|    .||.::....:...
Zfish   198 YNPD--QDGSDSPR---------------SSLNNSLSDQSLASVNLN----SVGSVHSYTPVTSH 241

  Fly   634 KESVRRIIS-------------NDQHIIELNPADLNAT----------DGYNQQPALKRARVDIN 675
            .|||.:.:|             .|:.::.....||:|:          ..||||..:        
Zfish   242 PESVSQSMSLQQAPQAQYSIPDRDKQLLFSEFEDLSASFRSLYKTVFEQSYNQQSLM-------- 298

  Fly   676 YAIGPAGELEQQYGQKVKVQQVIQPQQHP 704
               |...|..||.......|.  .|..||
Zfish   299 ---GLPSESSQQTHTSCSYQH--SPSSHP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 41/87 (47%)
foxj3NP_001313317.1 Forkhead 62..139 CDD:278670 40/78 (51%)
SelP_N <327..394 CDD:282453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.