DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxc1b

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_571804.1 Gene:foxc1b / 79375 ZFINID:ZDB-GENE-010302-2 Length:433 Species:Danio rerio


Alignment Length:225 Identity:61/225 - (27%)
Similarity:99/225 - (44%) Gaps:48/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 MQSNYSLGSPSSLSSSSASSPLGNVSNL---VNIANNNTSGAGSGLVKPLQQ-----KVKLP--- 403
            ||:.|.:         |:.||||.|..:   .......|.|..:|:..|:..     ..:.|   
Zfish     1 MQARYPV---------SSQSPLGVVPYIPGDQGFYRTATGGGYTGMPAPMSMYSHATHEQYPGGM 56

  Fly   404 --------PVGSP--FPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNS 458
                    |...|  ..||.|||..||.:|::||....:.::.||.|:.:.||::.:...||:||
Zfish    57 ARAYGPYAPAQQPKDMVKPPYSYIALITMAIQNSSDKKITLNGIYQFIMERFPFYRDNKQGWQNS 121

  Fly   459 VRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMD-----EEVQKWSRKDPAAIRGAMVY 518
            :|||||||:||.|:  |..:....||..|.::||..|..:     ...:::.:||        |.
Zfish   122 IRHNLSLNECFVKV--PRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKD--------VL 176

  Fly   519 PQHLESLERGEMKHGSADSDVELDSQSEIE 548
            .:..:...:|:...|.|   .|.|:|..::
Zfish   177 REKEDRDRQGKDNPGQA---CEQDAQQPVK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 36/92 (39%)
foxc1bNP_571804.1 Forkhead 74..160 CDD:278670 36/87 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..250 8/41 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.