DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxj1a

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001070174.2 Gene:foxj1a / 767737 ZFINID:ZDB-GENE-060929-1178 Length:458 Species:Danio rerio


Alignment Length:372 Identity:94/372 - (25%)
Similarity:139/372 - (37%) Gaps:117/372 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 SIASAANSPHHQMQSNYSLGSPSS----LSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQ 398
            ||.:|:...|         .||||    :.|.:.||||  ..:..:|....|.|      ||...
Zfish    62 SILNASTGQH---------TSPSSHSHLMGSDAPSSPL--AGDPASIGMPLTPG------KPTAA 109

  Fly   399 KVKLPPVGSPFP--------------------KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQ 443
            .....|:.|..|                    ||.|||:.||.:|::.|:...:.:|.||.::..
Zfish   110 SFCRVPMFSALPSLVAHGHCPDEVDYKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITD 174

  Fly   444 HFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQKWSRKD 508
            :|.||.:|...|:||:||||||||||.|:  |.......||..|.::|....::..|..|..|..
Zfish   175 NFCYFRHADPTWQNSIRHNLSLNKCFIKV--PRQKDEPGKGGFWKIDPQYAERLLNEAYKKRRLP 237

  Fly   509 PAAIRGAMVYPQHLESLERGEMKHGSADSDVELDSQSEIEESSDLEEHEFEDTMVDAMLVEEE-- 571
            |..|..|:.:...:.:...|.:   |.:..|..:||..::   |.||....|...|..|.|..  
Zfish   238 PVQINPALQHRLRMNAQATGVI---SRNLSVSPESQQLLK---DFEEATSADQNWDPRLAEATML 296

  Fly   572 ----------------------------------DEEED-----GDDD-----------EQIIND 586
                                              ||:||     |:.|           |..:|:
Zfish   297 SCWISGKGTNKRKQPYNHRTGKTPRRSSSPLLVMDEQEDLSSLRGNFDWDALLDSALNGELSLNE 361

  Fly   587 FD-----AEDER------HANGNQANNLPI-NHPLL-GQKSNDFDIE 620
            ..     .:||.      |.:..:|   |: ||.|: .|:|.|.|.:
Zfish   362 GSPLSPTPQDEELMIRGTHISPQEA---PVENHVLMETQRSGDEDFD 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/87 (40%)
foxj1aNP_001070174.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..99 11/41 (27%)
Forkhead 142..228 CDD:278670 35/87 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..324 0/18 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.