DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxk2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_011247520.1 Gene:Foxk2 / 68837 MGIID:1916087 Length:690 Species:Mus musculus


Alignment Length:271 Identity:70/271 - (25%)
Similarity:115/271 - (42%) Gaps:55/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 STTPKSIASAANSPHHQMQSNYS---LGSPSSLSS--SSASSPLGNVSNLVNIANNNTSGAGS-- 390
            |:..:....|..||...:|.:.|   :..|.:::.  |...||.|.:| ..|...::..||||  
Mouse   188 SSEKREKQEAPESPVKPVQPHISPLTINIPDTMAHLISPLPSPTGTIS-AANSCPSSPRGAGSSG 251

  Fly   391 ---GLVKP---------LQQKVKLPPVGSPFP----KPAYSYSCLIALALKNSRAGSLPVSEIYS 439
               |.|.|         .|.:.:....|...|    ||.|||:.||..|:..:....|.::.||:
Mouse   252 YKVGRVMPSDLSLMADNSQPENEKEASGGDSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYT 316

  Fly   440 FLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQKW 504
            .:.:::||:..|..||:||:|||||||:.|.|:  |.:.....||..|.::|...:|:.|:..:.
Mouse   317 HITKNYPYYRTADKGWQNSIRHNLSLNRYFIKV--PRSQEEPGKGSFWRIDPASESKLVEQAFRK 379

  Fly   505 SRK----------DPAAIRGAMVYPQHL-------------ESLERG------EMKHGSADSDVE 540
            .|.          .|.:.|.|...|.|.             |||.|.      |.:.|::...:.
Mouse   380 RRPRGVPCFRTPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGASQPKLA 444

  Fly   541 LDSQSEIEESS 551
            :..::...:|:
Mouse   445 VIQEARFAQSA 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 33/87 (38%)
Foxk2XP_011247520.1 FHA 41..>124 CDD:238017
COG5025 <175..>381 CDD:227358 57/195 (29%)
Forkhead 287..373 CDD:365978 33/87 (38%)
PHA03247 <380..683 CDD:223021 13/76 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.