Sequence 1: | NP_524302.1 | Gene: | jumu / 41265 | FlyBaseID: | FBgn0015396 | Length: | 719 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011247520.1 | Gene: | Foxk2 / 68837 | MGIID: | 1916087 | Length: | 690 | Species: | Mus musculus |
Alignment Length: | 271 | Identity: | 70/271 - (25%) |
---|---|---|---|
Similarity: | 115/271 - (42%) | Gaps: | 55/271 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 333 STTPKSIASAANSPHHQMQSNYS---LGSPSSLSS--SSASSPLGNVSNLVNIANNNTSGAGS-- 390
Fly 391 ---GLVKP---------LQQKVKLPPVGSPFP----KPAYSYSCLIALALKNSRAGSLPVSEIYS 439
Fly 440 FLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQKW 504
Fly 505 SRK----------DPAAIRGAMVYPQHL-------------ESLERG------EMKHGSADSDVE 540
Fly 541 LDSQSEIEESS 551 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jumu | NP_524302.1 | Forkhead | 411..499 | CDD:278670 | 33/87 (38%) |
Foxk2 | XP_011247520.1 | FHA | 41..>124 | CDD:238017 | |
COG5025 | <175..>381 | CDD:227358 | 57/195 (29%) | ||
Forkhead | 287..373 | CDD:365978 | 33/87 (38%) | ||
PHA03247 | <380..683 | CDD:223021 | 13/76 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |