DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxl1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_006255788.1 Gene:Foxl1 / 687553 RGDID:1584212 Length:341 Species:Rattus norvegicus


Alignment Length:295 Identity:78/295 - (26%)
Similarity:122/295 - (41%) Gaps:54/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 IASAANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLP 403
            :|:.|.||...:.|....|.|.:.:.::|.                   ||.|.|:|.|      
  Rat     9 LAALAASPLLYVYSPERPGLPLAFAPATAL-------------------AGPGRVEPPQ------ 48

  Fly   404 PVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKC 468
                   ||.|||..|||:|::::....:.::.||.|:...||::.:...||:||:|||||||:|
  Rat    49 -------KPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNEC 106

  Fly   469 FEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLESLERGEMKHG 533
            |.|:  |...|...||..|.::|..::..:....:..::.|....|:   |:...:  |.|.:..
  Rat   107 FVKV--PREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPAAGS---PEAKRT--RVEPRES 164

  Fly   534 SADSDV---ELDSQSEIEESSDLEEHEFEDTMVDAMLVEEEDEEEDGDDDEQIINDFDA----ED 591
            ....||   .|.:...:.|....:......|...|:|.....|..|.|.| :.|.|..|    :.
  Rat   165 EVGCDVGSPNLATARPMHEPDRSQSPAAGGTARSALLPWPGPELRDPDAD-RTIQDAGAVASGQL 228

  Fly   592 ER------HANGNQANNLPINHPLLGQKSNDFDIE 620
            ||      |..|:.....|...| .|.||..|.|:
  Rat   229 ERPVHYPVHHLGSSLRPAPSGSP-KGSKSKSFSID 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 34/87 (39%)
Foxl1XP_006255788.1 FH 49..137 CDD:214627 34/89 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.