DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxg1c

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001038680.1 Gene:foxg1c / 571323 ZFINID:ZDB-GENE-050419-26 Length:379 Species:Danio rerio


Alignment Length:228 Identity:61/228 - (26%)
Similarity:99/228 - (43%) Gaps:44/228 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 SNMGLKREDSNKRGLQASTTPKSIASAANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVNI 380
            |::.|:.|.:..   .|...|:|.::...:..||                .|..|:...:.||..
Zfish    19 SSLLLRHERARS---DAQEAPRSRSAKPPARCHQ----------------PADKPVRERNELVTR 64

  Fly   381 ANNNTSGAGSGLVKPLQQKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHF 445
            ....     .|:.:|..:...:|...|...||.:||:.||.:|::.|....|.::.||.|:..:|
Zfish    65 TEKK-----DGVGEPKCEGTDVPEKKSKPDKPPFSYNALIMMAIRQSPERRLTLNGIYEFIMGNF 124

  Fly   446 PYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEEV------QKW 504
            ||:.....||:||:||||||||||.|:  |....:..||..|.::|.     .::|      .|.
Zfish   125 PYYRENRQGWQNSIRHNLSLNKCFVKV--PRHYDDPGKGNYWMLDPS-----SDDVFIGGTTGKL 182

  Fly   505 SRKDPAAIRGAMVYPQHLESLERGEMKHGSADS 537
            .|:..||.|..:       :::||.....:|.|
Zfish   183 RRRSTAASRAKL-------AMKRGARLSSTAAS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/87 (40%)
foxg1cNP_001038680.1 FH 90..178 CDD:214627 36/94 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.