DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxr1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001096594.1 Gene:foxr1 / 570997 ZFINID:ZDB-GENE-070928-26 Length:321 Species:Danio rerio


Alignment Length:218 Identity:62/218 - (28%)
Similarity:98/218 - (44%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 STTPKSIASAANSP------------------HHQMQSNYSLGSPSSLSSSSASSPL-----GNV 374
            :|.||.....:::|                  ...:.|.|.|....  .:||...|:     |..
Zfish   105 TTPPKPAVPRSSTPVSDPPLLPDETCLNESVQDTSVSSEYQLTDED--DASSVDVPICRKVKGTR 167

  Fly   375 SNLVNIANNNTSGAGSG--LVKPLQQKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEI 437
            ......||....|....  |.:.||..:.|.  ...:|:|..:|..|||:||.:||:|||.|.:|
Zfish   168 KGRTPKANTRRLGLTQSRRLQRALQDSMSLK--SGVWPRPPVNYCILIAMALSSSRSGSLNVQQI 230

  Fly   438 YSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQ 502
            |:|..:|||:|..||.||||::||||..:..|:|..:..:...:||.|.|.:..|...::.:|:.
Zfish   231 YNFTREHFPFFLTAPDGWKNTIRHNLCFSNSFKKTPQQVSGDGKRKSCLWHLTLDGRQRLRDEIH 295

  Fly   503 KWSRKDPAAIRGAMVYPQHLESL 525
            ..:......:|.:|.||..:.:|
Zfish   296 TLTEDSFRLLRRSMNYPDMIPAL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 37/87 (43%)
foxr1NP_001096594.1 Forkhead 204..292 CDD:278670 37/87 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.