DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxe3

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001073150.2 Gene:foxe3 / 570855 ZFINID:ZDB-GENE-061214-6 Length:422 Species:Danio rerio


Alignment Length:220 Identity:61/220 - (27%)
Similarity:88/220 - (40%) Gaps:61/220 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 ANSPHHQMQS--------NYSLGSPSSL------------------SSSSASSPLGNVSNLVNIA 381
            |.|.|...::        |.||.||..|                  :....|||..:...:|::.
Zfish    17 AESQHSPAEAASPVVVSPNVSLDSPVPLPPLALNHQARTKDGILIKAEPQGSSPNTDREEVVSLG 81

  Fly   382 NNNTSGAGSGLVKPLQQKVKLPPVGS-----PFP--KPAYSYSCLIALALKNSRAGSLPVSEIYS 439
                           |.:..||..||     |..  ||.|||..|||:|:.||....|.:..||.
Zfish    82 ---------------QTEEHLPATGSRRRKRPVQRGKPPYSYIALIAMAIANSPERKLTLGGIYK 131

  Fly   440 FLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMD-----E 499
            |:.:.||::......|:||:||||:||.||.||  |...|...||..|.::|...:..|     .
Zfish   132 FIMERFPFYRENSKKWQNSIRHNLTLNDCFVKI--PREPGRPGKGNYWTLDPAAEDMFDNGSFLR 194

  Fly   500 EVQKWSRKDPAAIRGAMVYPQHLES 524
            ..:::.|.|      ...||.:::|
Zfish   195 RRKRFKRTD------VSTYPGYMQS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 37/92 (40%)
foxe3NP_001073150.2 FH 103..191 CDD:214627 37/89 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.