DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxe1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_005159967.1 Gene:foxe1 / 567676 ZFINID:ZDB-GENE-061116-1 Length:354 Species:Danio rerio


Alignment Length:99 Identity:39/99 - (39%)
Similarity:56/99 - (56%) Gaps:13/99 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 KPLQQKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNS 458
            :|||:           .||.|||..||::|:.||....|.:..||.|:.:.||::.:....|:||
Zfish    34 RPLQR-----------GKPPYSYIALISMAIANSPDRKLTLGGIYKFITERFPFYRDNSKKWQNS 87

  Fly   459 VRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPD 492
            :||||:||.||.||  |...|...||..||::|:
Zfish    88 IRHNLTLNDCFIKI--PREPGRPGKGNYWALDPN 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 36/82 (44%)
foxe1XP_005159967.1 FH 40..128 CDD:214627 36/82 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.