DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxq2

DIOPT Version :10

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001098411.3 Gene:foxq2 / 565796 ZFINID:ZDB-GENE-050208-663 Length:244 Species:Danio rerio


Alignment Length:125 Identity:46/125 - (36%)
Similarity:72/125 - (57%) Gaps:10/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERP 475
            |||.||..||::|:.:|....|.:.:||.::..|:|||::....|:||||||||||:||.|..| 
Zfish    87 KPAQSYIALISMAILDSDEKKLLLCDIYQWIMDHYPYFKSKDKNWRNSVRHNLSLNECFIKAGR- 150

  Fly   476 ATNGNQRKGCRWAMNPDRINKMD--EEVQKWSRKDPAAIRGAMVY--PQHLESLERGEMK 531
            :.||   ||..||::|.......  :..::.:|:....:.|.:.|  |.|.::|  |.:|
Zfish   151 SDNG---KGHFWAIHPANFQDFSNGDYHRRRARRRIRRVTGQLPYALPAHYQTL--GHLK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 COG5025 <254..>523 CDD:227358 43/115 (37%)
FH_FOXN1-like 411..491 CDD:410804 37/79 (47%)
foxq2NP_001098411.3 None

Return to query results.
Submit another query.