DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxi2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001016544.1 Gene:foxi2 / 549298 XenbaseID:XB-GENE-982122 Length:350 Species:Xenopus tropicalis


Alignment Length:265 Identity:73/265 - (27%)
Similarity:120/265 - (45%) Gaps:60/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 NMGLKREDSNKRGLQASTTPKSIASAANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVNIA 381
            :..|..:..|::..|....|.::....|        .||  ||::......:.|..|.|..:|..
 Frog     7 HFSLYHQQQNQQLPQRPAAPPALGYGRN--------EYS--SPTASPYPWLNGPAMNSSPYLNGG 61

  Fly   382 NNN---TSGAGSGLVKPLQQKVKLPPVG----SPFP--------------KPAYSYSCLIALALK 425
            :.:   .:|.|.|      |:..:||..    :.||              :|.||||.|||:|::
 Frog    62 SGSPYFPAGYGGG------QRQFIPPSSGFGVADFPWLSIPNQADLLKMVRPPYSYSSLIAMAIQ 120

  Fly   426 NSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMN 490
            |:....|.:|:|||::.::||:::.:.:||:||:|||||||.||:|:.|  .:.:..||..|.::
 Frog   121 NNPEKKLTLSQIYSYVAENFPFYKKSKAGWQNSIRHNLSLNDCFKKVAR--DDNDPGKGNYWTLD 183

  Fly   491 PDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLESLERG------EMKHGSADSDVELDS---QSE 546
            |:.....|....:..||            :..||:|.|      |.|...|...:..||   .|.
 Frog   184 PNCEKMFDNGNFRRKRK------------RKSESVEAGFDGDASEDKKELALKSLGSDSPRGASA 236

  Fly   547 IEESS 551
            :|:||
 Frog   237 LEQSS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 36/87 (41%)
foxi2NP_001016544.1 Forkhead 106..192 CDD:278670 36/87 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.