DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxj2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_006237373.1 Gene:Foxj2 / 502886 RGDID:1565101 Length:623 Species:Rattus norvegicus


Alignment Length:416 Identity:101/416 - (24%)
Similarity:151/416 - (36%) Gaps:117/416 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 GLKREDSNKRGLQASTTPKSIASAANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANN 383
            |::|:........||....|:.|....|...:::..     ..|.|:|.:.|.|...        
  Rat    29 GMRRDCQEPGSTMASDLESSLTSIDWLPQLTLRATI-----EKLGSASQAGPPGGTR-------- 80

  Fly   384 NTSGAGSGLVKPLQQKVKLPPVGSPFP----------------KPAYSYSCLIALALKNSRAGSL 432
                             |..| |||..                ||.|||:.||..|:.:|.|..:
  Rat    81 -----------------KCSP-GSPTDPNATLSKDEASVHQDGKPRYSYATLITYAINSSPAKKM 127

  Fly   433 PVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMN--PD--- 492
            .:||||.::|.:|||::||..|||||:||||||||||.|:.||  ..:..||..|.::  ||   
  Rat   128 TLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSLNKCFRKVPRP--RDDPGKGSYWTIDTCPDISR 190

  Fly   493 -RINKMDEEVQKWSRKDPAAIRGAMVYPQHLESLERGEMKHGSADSDVELDSQSEIEESSDLEEH 556
             |.:..|:::.:.|.:..|:           :|...|....|.|....|.:.|..::..|.:..:
  Rat   191 KRRHPPDDDLSQDSPEQEAS-----------KSPRGGVPGSGEASLSHEGNPQMSLQSPSSMASY 244

  Fly   557 EFEDTMVDAMLVEEEDEEEDGDDDEQIINDFDAEDERHANGNQANNLPINHPLLGQKSNDFDIEV 621
            ......||...|                          |.|..........|.|...::||... 
  Rat   245 SQGPGPVDGGAV--------------------------AAGAPGQESTEGAPPLYNTNHDFKFS- 282

  Fly   622 GDLYDAIDIEDDKESVRRII-------SNDQHIIELNPADLNATDGYNQQPALKRARVDINYAIG 679
               |..|:.:|...|.|.:.       |:.||.......|:..::.|              |...
  Rat   283 ---YSEINFQDLSWSFRNLYKSMLERSSSSQHGFSSLLGDMPPSNNY--------------YMYQ 330

  Fly   680 PAGELEQQYGQKVKVQQVIQPQQHPP 705
            ...:.:||..|:.:.||..|.||.||
  Rat   331 QQQQQQQQQQQQQQQQQQQQQQQQPP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 44/93 (47%)
Foxj2XP_006237373.1 Forkhead 106..183 CDD:278670 41/78 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.