DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxi3

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001102819.1 Gene:Foxi3 / 502846 RGDID:1561816 Length:400 Species:Rattus norvegicus


Alignment Length:277 Identity:75/277 - (27%)
Similarity:117/277 - (42%) Gaps:59/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 PGIGGLTFANSAAYQKLKQTSLVKSPGGISPGAGSNMGLKREDSNKRGLQASTTPKSIASAANSP 346
            ||:||.  |::|.|     ......|.|.:|||              .||....|.:.|.|    
  Rat    52 PGVGGP--ASAAGY-----LGAPPPPPGAAPGA--------------FLQPPAAPGTFAGA---- 91

  Fly   347 HHQMQSNY---SLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLPPVGSP 408
                |..:   |..:|:|.:.|:|...||.:|          ..:...|:|.:            
  Rat    92 ----QRGFTQPSAAAPASPAGSAAPGELGWLS----------MASREDLMKMV------------ 130

  Fly   409 FPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIE 473
              :|.||||.|||:|::::....|.:|.||.|:..:||:::.:.:||:||:|||||||.||:|: 
  Rat   131 --RPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLNDCFKKV- 192

  Fly   474 RPATNGNQRKGCRWAMNPDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLESLERGEMKHGSADSD 538
             |....:..||..|.::|:.....|....:..|:..|.....:..|.. .|...|:.........
  Rat   193 -PRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRAEASSNLTVPSG-TSKSDGQSSRLRVSGK 255

  Fly   539 VELDSQSEIEESSDLEE 555
            :|.||.|.:...|...|
  Rat   256 LEGDSPSSMLRPSQSPE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/87 (40%)
Foxi3NP_001102819.1 Forkhead 131..217 CDD:278670 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.