DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxj1b

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001008648.1 Gene:foxj1b / 494105 ZFINID:ZDB-GENE-041212-76 Length:442 Species:Danio rerio


Alignment Length:417 Identity:100/417 - (23%)
Similarity:157/417 - (37%) Gaps:88/417 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 STTPKSIASAANSPHHQMQSNYSLGSPSSLSSSSASSPLGN--VSNLVNIANNNTSGAGSGLVKP 395
            |..|:...|:...|.|.......||.    :.|.:|.|.|:  .:.:.....|.|:.. |.|..|
Zfish    51 SANPERTPSSGCHPQHLFYYKNQLGG----TDSPSSPPAGDTAATGMPQTPGNPTTSC-SSLANP 110

  Fly   396 --LQQKVKLPPVGSPFP------------KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFP 446
              |||..:. ..|...|            ||.|||:.||.:|::.|....:.:|.|||::.::|.
Zfish   111 YALQQAGQY-ITGQTNPAEEIDYKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFC 174

  Fly   447 YFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQKWSRKDPAA 511
            |:..|...|:||:||||||||||.|:  |.......||..|.::|...:.....|.| .|:.||.
Zfish   175 YYRYAEPSWQNSIRHNLSLNKCFMKV--PRQKDEPGKGGFWQIDPQYADMFVNGVFK-RRRMPAT 236

  Fly   512 IRGAMVYPQHLESLERGEMKHGSADSDVELDSQSEIEESSDLEEHEFEDTMVDAMLVEEEDEEED 576
                     :..:..:.:|....:.|     ..|:..:...:...:                   
Zfish   237 ---------NFNTQRQSKMLSSPSSS-----YTSQCNQQMGMGHFQ------------------- 268

  Fly   577 GDDDEQIINDFDAEDERHANGNQANNLPINHPLLGQKSNDFDIEVGDLYDAIDIEDDKESVRRII 641
            |:..:|   ||.....:.|..:::       |||.......|:..|| :|...:.||..|.....
Zfish   269 GNKRKQ---DFPKRGNKLARISKS-------PLLTSDIKTSDVLRGD-FDLASVFDDVLSGNDST 322

  Fly   642 SNDQHI--------IELNP-ADLNATDGYNQQPALKRARVDINYAIGPAGE--LEQQYGQKVKVQ 695
            ..|..|        .|:.| :.::...||:.:.....|.::.|..||...|  ..||:.|:.:|.
Zfish   323 FEDLDINTALSSLGCEMEPSSQIHNQSGYSNEDEQACAYLEANGIIGCNMEDFHHQQHHQQAQVH 387

  Fly   696 QVI--------QPQQHPPTYNRRKMPL 714
            ...        |.||||........|:
Zfish   388 PQYYEGMFSDQQNQQHPWEIKEEAQPV 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/87 (40%)
foxj1bNP_001008648.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..106 8/37 (22%)
Forkhead 139..225 CDD:278670 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.